🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

P2RX4

설명P2X purinoceptor 4

Gene and Protein Information

Gene ID5025
Uniprot Accession IDs Q99571 E7EPF7 F6RU17 O00450 O14722 Q5U089 Q5U090 Q8N4N1 Q9UBG9 P2X4
Ensembl ID ENSP00000353032
Symbol P2X4 P2X4R
FamilyBelongs to the P2X receptor family.
Sequence
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp452319P2RX4purinergic receptor P2X 49598VGNC:8487OMA, EggNOG
Macaque702536P2RX4purinergic receptor P2X 49544Inparanoid, OMA, EggNOG
Mouse18438P2rx4purinergic receptor P2X, ligand-gated ion channel 410090MGI:1338859Inparanoid, OMA, EggNOG
Rat29659P2rx4purinergic receptor P2X 410116RGD:62073Inparanoid, OMA, EggNOG
Dog448783P2RX4purinergic receptor P2X 49615VGNC:44210Inparanoid, OMA, EggNOG
Horse100059626P2RX4purinergic receptor P2X 49796VGNC:50960Inparanoid, OMA, EggNOG
Cow338036P2RX4purinergic receptor P2X 49913VGNC:32520Inparanoid, OMA, EggNOG
Opossum100618270P2RX4purinergic receptor P2X 413616Inparanoid, OMA, EggNOG
PlatypusP2RX4purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535]9258OMA, EggNOG
Chicken374166P2RX4purinergic receptor P2X 49031CGNC:2857Inparanoid, OMA
Anole lizard100561452p2rx4purinergic receptor P2X 428377Inparanoid, OMA
Xenopus100489363p2rx4purinergic receptor P2X, ligand gated ion channel, 48364XB-GENE-967965Inparanoid, OMA
Zebrafish259258p2rx4apurinergic receptor P2X, ligand-gated ion channel, 4a7955ZDB-GENE-020806-2Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    ATP-gated p2x receptor cation channel (p2x receptor) family    /    P2X purinoceptor 4

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 사양Species reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.