🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS CoA Structure
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

P2RX7

설명P2X purinoceptor 7

Gene and Protein Information

Gene ID5027
Uniprot Accession IDs Q99572 A8K2Z0 E7EMK6 F5H6P2 F5H7E8 F8W951 O14991 Q4VKH8 Q4VKH9 Q4VKI0 Q4VKI1 Q4VKI2 Q4VKI3 Q4VKI4 Q7Z771 Q96EV7 P2X7
Ensembl ID ENSP00000330696
Symbol P2X7
FamilyBelongs to the P2X receptor family.
Sequence
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Macaque699455P2RX7purinergic receptor P2X 79544Inparanoid, OMA
Mouse18439P2rx7purinergic receptor P2X, ligand-gated ion channel, 710090MGI:1339957Inparanoid, OMA
Rat29665P2rx7purinergic receptor P2X 710116RGD:3241Inparanoid, OMA
Dog448778P2RX7purinergic receptor P2X 79615VGNC:44212Inparanoid, OMA
Horse100058464P2RX7purinergic receptor P2X 79796VGNC:21108Inparanoid, OMA
Cow286814P2RX7purinergic receptor P2X 79913VGNC:32522Inparanoid, OMA
PigP2RX7purinergic receptor P2X 7 [Source:HGNC Symbol;Acc:HGNC:8537]9823Inparanoid, OMA
Chicken771952P2RX7purinergic receptor P2X 79031CGNC:2831Inparanoid, OMA
Anole lizard100561255p2rx7purinergic receptor P2X 728377Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    ATP-gated p2x receptor cation channel (p2x receptor) family    /    P2X purinoceptor 7

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.