🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

P2RY1

설명P2Y purinoceptor 1

Gene and Protein Information

Gene ID5028
Uniprot Accession IDs P47900 P2Y1
Ensembl ID ENSP00000304767
Symbol P2Y1 SARCC
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp470970P2RY1purinergic receptor P2Y19598VGNC:12119OMA, EggNOG
Macaque708507P2RY1purinergic receptor P2Y19544Inparanoid, OMA, EggNOG
Mouse18441P2ry1purinergic receptor P2Y, G-protein coupled 110090MGI:105049Inparanoid, OMA, EggNOG
Rat25265P2ry1purinergic receptor P2Y110116RGD:3242Inparanoid, OMA, EggNOG
Dog449621P2RY1purinergic receptor P2Y19615VGNC:44213Inparanoid, OMA, EggNOG
Horse100055494P2RY1purinergic receptor P2Y19796VGNC:21109Inparanoid, OMA, EggNOG
Cow281963P2RY1purinergic receptor P2Y19913VGNC:32523Inparanoid, OMA, EggNOG
Pig503666P2RY1purinergic receptor P2Y19823Inparanoid, OMA, EggNOG
Opossum100020509P2RY1purinergic receptor P2Y113616Inparanoid, OMA, EggNOG
Platypus100080337P2RY1purinergic receptor P2Y19258Inparanoid, OMA, EggNOG
Chicken396275P2RY1purinergic receptor P2Y19031CGNC:49730Inparanoid, OMA, EggNOG
Anole lizard100558926p2ry1purinergic receptor P2Y128377Inparanoid, OMA, EggNOG
Xenopus100124773p2ry1purinergic receptor P2Y, G-protein coupled, 18364XB-GENE-1000145Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Purinoceptor    /    P2Y receptor    /    P2y purinoceptor 1

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 사양Species reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.