| 설명 | P2X purinoceptor 1 |
|---|
Gene and Protein Information
| Gene ID | 5023 |
|---|---|
| Uniprot Accession IDs | P51575 Q9UK84 P2X1 |
| Ensembl ID | ENSP00000225538 |
| Symbol | P2X1 P2X1 |
| Family | Belongs to the P2X receptor family. |
| Sequence | MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454439 | P2RX1 | purinergic receptor P2X 1 | 9598 | VGNC:9500 | OMA, EggNOG |
| Macaque | 707658 | P2RX1 | purinergic receptor P2X 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18436 | P2rx1 | purinergic receptor P2X, ligand-gated ion channel, 1 | 10090 | MGI:1098235 | Inparanoid, OMA, EggNOG |
| Rat | 25505 | P2rx1 | purinergic receptor P2X 1 | 10116 | RGD:3240 | Inparanoid, OMA, EggNOG |
| Dog | 491223 | P2RX1 | purinergic receptor P2X 1 | 9615 | VGNC:44207 | Inparanoid, OMA, EggNOG |
| Horse | 100060689 | P2RX1 | purinergic receptor P2X 1 | 9796 | VGNC:21106 | Inparanoid, OMA, EggNOG |
| Cow | 514898 | P2RX1 | purinergic receptor P2X 1 | 9913 | VGNC:32517 | OMA, EggNOG |
| Pig | 106504105 | P2RX1 | purinergic receptor P2X 1 | 9823 | OMA, EggNOG | |
| Xenopus | P2RX1 | purinergic receptor P2X 1 [Source:HGNC Symbol;Acc:HGNC:8533] | 8364 | OMA, EggNOG | ||
| Zebrafish | 387296 | p2rx1 | purinergic receptor P2X, ligand-gated ion channel, 1 | 7955 | ZDB-GENE-030319-1 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 1
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 1
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.