CTSZ

설명Cathepsin Z

Gene and Protein Information

Gene ID1522
Uniprot Accession IDs Q9UBR2 B2RC40 O75331 Q9UQV5 Q9UQV6
Ensembl ID ENSP00000217131
Symbol CTSX
FamilyBelongs to the peptidase C1 family.
Sequence
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp736240CTSZcathepsin Z9598VGNC:6087OMA, EggNOG
Macaque694157CTSZcathepsin Z9544OMA, EggNOG
Mouse64138Ctszcathepsin Z10090MGI:1891190Inparanoid, OMA, EggNOG
Rat252929Ctszcathepsin Z10116RGD:708479Inparanoid, OMA, EggNOG
Dog611983CTSZcathepsin Z9615VGNC:39717Inparanoid, OMA, EggNOG
Horse100056600CTSZcathepsin Z9796VGNC:16957Inparanoid, OMA, EggNOG
Cow404187CTSZcathepsin Z9913VGNC:27820Inparanoid, OMA, EggNOG
Pig100141405CTSZcathepsin Z9823Inparanoid, OMA, EggNOG
Opossum100027054CTSZcathepsin Z13616Inparanoid, EggNOG
Chicken419311CTSZcathepsin Z9031CGNC:5626Inparanoid, OMA, EggNOG
Xenopus100127597ctszcathepsin Z8364XB-GENE-959211Inparanoid, OMA, EggNOG
Zebrafish450022ctszcathepsin Z7955ZDB-GENE-041010-139Inparanoid, OMA, EggNOG
C. elegans171829cpz-1CathePsin Z6239Inparanoid, OMA

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.