🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

CBX6

설명Chromobox protein homolog 6

Gene and Protein Information

Gene ID23466
Uniprot Accession IDs O95503 A8KAH0 Q96EM5
Ensembl ID ENSP00000384490
Sequence
MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Mouse494448Cbx6chromobox 610090MGI:3512628Inparanoid, OMA, EggNOG
Rat315136Cbx6chromobox 610116RGD:1307314Inparanoid, OMA
Cow513830CBX6chromobox 69913VGNC:26819Inparanoid, OMA
OpossumCBX6chromobox 6 [Source:HGNC Symbol;Acc:HGNC:1556]13616Inparanoid, OMA, EggNOG
Xenopus549371cbx6chromobox 68364XB-GENE-951161Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-lysine/arginine binding protein    /    Chromodomain    /    Chromobox protein homolog 6

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 사양Species reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.