🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

PDF

설명Peptide deformylase, mitochondrial

Gene and Protein Information

Gene ID64146
Uniprot Accession IDs Q9HBH1 Q8WUN6
Ensembl ID ENSP00000288022
Symbol PDF1A
FamilyBelongs to the polypeptide deformylase family.
Sequence
MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Rat690214Pdfpeptide deformylase (mitochondrial)10116RGD:1582894Inparanoid, OMA, EggNOG
Dog610955PDFpeptide deformylase, mitochondrial9615VGNC:49608Inparanoid, OMA, EggNOG
Cow788473PDFpeptide deformylase, mitochondrial9913VGNC:49562Inparanoid, OMA, EggNOG
Opossum100027986PDFpeptide deformylase, mitochondrial13616Inparanoid, EggNOG
Anole lizard100560353pdfpeptide deformylase, mitochondrial28377Inparanoid, OMA, EggNOG
Xenopus448425pdfpeptide deformylase, mitochondrial8364XB-GENE-1010345Inparanoid, OMA, EggNOG
Zebrafish619248pdfpeptide deformylase, mitochondrial7955ZDB-GENE-050913-42Inparanoid, OMA, EggNOG
Fruitfly318700CG31373CG31373 gene product from transcript CG31373-RA7227FBgn0051373Inparanoid, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.