🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

CD79A

설명B-cell antigen receptor complex-associated protein alpha chain

Gene and Protein Information

Gene ID973
Uniprot Accession IDs P11912 A0N775 Q53FB8
Ensembl ID ENSP00000221972
Symbol IGA MB1 IGA MB-1
Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp740560CD79ACD79a molecule9598VGNC:3643OMA, EggNOG
Mouse12518Cd79aCD79A antigen (immunoglobulin-associated alpha)10090MGI:101774Inparanoid, OMA, EggNOG
Rat100913063Cd79aCD79a molecule10116RGD:6484896OMA, EggNOG
Dog484483CD79ACD79a molecule9615VGNC:38973Inparanoid, OMA, EggNOG
Horse100052219CD79ACD79a molecule9796VGNC:16279Inparanoid, OMA, EggNOG
Cow281674CD79ACD79a molecule9913VGNC:27046Inparanoid, OMA, EggNOG
Anole lizard103282538cd79aCD79a molecule28377Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    defense/immunity protein    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    cytokine receptor    /    B-cell antigen receptor complex-associated protein alpha chain
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.