CDK5

설명Cyclin-dependent-like kinase 5

Gene and Protein Information

Gene ID1020
Uniprot Accession IDs Q00535 A1XKG3
Ensembl ID ENSP00000419782
Symbol CDKN5 LIS7 PSSALRE
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp463891CDK5cyclin dependent kinase 59598VGNC:7364OMA, EggNOG
Macaque714445CDK5cyclin dependent kinase 59544Inparanoid, OMA, EggNOG
Mouse12568Cdk5cyclin-dependent kinase 510090MGI:101765Inparanoid, OMA, EggNOG
Rat140908Cdk5cyclin-dependent kinase 510116RGD:70514Inparanoid, OMA
Dog475537CDK5cyclin dependent kinase 59615VGNC:51795Inparanoid, OMA, EggNOG
Horse100063442CDK5cyclin dependent kinase 59796VGNC:16349Inparanoid, OMA, EggNOG
Cow281066CDK5cyclin dependent kinase 59913VGNC:27127Inparanoid, OMA, EggNOG
Pig733700CDK5cyclin dependent kinase 59823Inparanoid, OMA, EggNOG
Opossum100015241CDK5cyclin dependent kinase 513616Inparanoid, OMA, EggNOG
Xenopus780236cdk5cyclin-dependent kinase 58364XB-GENE-1010261Inparanoid, OMA, EggNOG
Zebrafish65234cdk5cyclin-dependent kinase 57955ZDB-GENE-010131-2Inparanoid, OMA, EggNOG
C. elegans176774cdk-5Cyclin-dependent-like kinase 56239Inparanoid, OMA
Fruitfly36727Cdk5Cyclin-dependent kinase 57227FBgn0013762Inparanoid, OMA

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.