🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

EDN2

설명Endothelin-2

Gene and Protein Information

Gene ID1907
Uniprot Accession IDs P20800 Q5T1R3 ET-2
Ensembl ID ENSP00000361668
Symbol ET2 ET-2 PPET2
FamilyBelongs to the endothelin/sarafotoxin family.
Sequence
MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp469298EDN2endothelin 29598VGNC:527OMA, EggNOG
Macaque695960EDN2endothelin 29544Inparanoid, OMA, EggNOG
Mouse13615Edn2endothelin 210090MGI:95284Inparanoid, OMA, EggNOG
Rat24324Edn2endothelin 210116RGD:2533Inparanoid, OMA, EggNOG
Dog403508EDN2endothelin 29615VGNC:40200Inparanoid, OMA, EggNOG
HorseEDN2endothelin 2 [Source:HGNC Symbol;Acc:HGNC:3177]9796OMA, EggNOG
Cow319094EDN2endothelin 29913VGNC:28328Inparanoid, OMA, EggNOG
Opossum100032585EDN2endothelin 213616Inparanoid, OMA, EggNOG
Chicken419559EDN2endothelin 29031CGNC:421Inparanoid, OMA, EggNOG
Zebrafish569550edn2endothelin 27955ZDB-GENE-060503-774Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    peptide hormone    /    Endothelin-2
DTO Classes
protein    /    Signaling    /    Hormone    /    Endothelin-2

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.