| 설명 | Prolactin-releasing peptide receptor |
|---|
Gene and Protein Information
| Gene ID | 2834 |
|---|---|
| Uniprot Accession IDs | P49683 O75194 Q502U8 Q5VXR9 PrRP receptor |
| Ensembl ID | ENSP00000239032 |
| Symbol | GPR10 GR3 GR3 GPR10 PrRPR |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466259 | PRLHR | prolactin releasing hormone receptor | 9598 | VGNC:5707 | OMA, EggNOG |
| Mouse | 226278 | Prlhr | prolactin releasing hormone receptor | 10090 | MGI:2135956 | Inparanoid, OMA, EggNOG |
| Rat | 246075 | Prlhr | prolactin releasing hormone receptor | 10116 | RGD:71037 | Inparanoid, OMA, EggNOG |
| Dog | 486911 | PRLHR | prolactin releasing hormone receptor | 9615 | VGNC:44993 | Inparanoid, OMA, EggNOG |
| Horse | 100066425 | PRLHR | prolactin releasing hormone receptor | 9796 | VGNC:21856 | Inparanoid, OMA, EggNOG |
| Cow | 510397 | PRLHR | prolactin releasing hormone receptor | 9913 | VGNC:33345 | Inparanoid, OMA, EggNOG |
| Anole lizard | PRLHR | prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464] | 28377 | Inparanoid, OMA | ||
| Fruitfly | 40195 | sNPF-R | short neuropeptide F receptor | 7227 | FBgn0036934 | Inparanoid, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Prolactin-releasing peptide receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Prolactin-releasing peptide receptor
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.