🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

CDC40

설명Pre-mRNA-processing factor 17

Gene and Protein Information

Gene ID51362
Uniprot Accession IDs O60508 B2RBC5 O75471 Q5SRN0 Q9UPG1
Ensembl ID ENSP00000357928
Symbol EHB3 PRP17 PRPF17 EHB3 PRP17 PRPF17
Sequence
MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp462936CDC40cell division cycle 409598VGNC:2657OMA, EggNOG
Macaque697474CDC40cell division cycle 409544Inparanoid, OMA, EggNOG
Mouse71713Cdc40cell division cycle 4010090MGI:1918963Inparanoid, OMA, EggNOG
Rat361859Cdc40cell division cycle 4010116RGD:1307063Inparanoid, OMA
Dog475025CDC40cell division cycle 409615VGNC:38996Inparanoid, OMA, EggNOG
Horse100066771CDC40cell division cycle 409796VGNC:16295Inparanoid, OMA, EggNOG
Cow514003CDC40cell division cycle 409913VGNC:27068Inparanoid, OMA, EggNOG
Pig100511111CDC40cell division cycle 409823Inparanoid, OMA, EggNOG
Opossum100022119CDC40cell division cycle 4013616Inparanoid, OMA, EggNOG
PlatypusCDC40cell division cycle 40 [Source:HGNC Symbol;Acc:HGNC:17350]9258OMA, EggNOG
Chicken421760CDC40cell division cycle 409031CGNC:11202Inparanoid, OMA, EggNOG
Xenopus496947cdc40cell division cycle 408364XB-GENE-954563Inparanoid, OMA, EggNOG
Zebrafish494534cdc40cell division cycle 40 homolog (S. cerevisiae)7955ZDB-GENE-050116-3Inparanoid, OMA, EggNOG
C. elegans172999prp-17yeast PRP (splicing factor) related6239Inparanoid, OMA
Fruitfly42593CG6015CG6015 gene product from transcript CG6015-RA7227FBgn0038927Inparanoid, EggNOG
S.cerevisiae851968CDC40Cdc40p4932S000002772Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Pre-mRNA-processing factor 17
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Pre-mRNA-processing factor 17

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.