🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

SLC36A2

설명Proton-coupled amino acid transporter 2

Gene and Protein Information

Gene ID153201
Uniprot Accession IDs Q495M3 Q495M4 Q495M6 Q6ZWK5 Q7Z6B5 Proton/amino acid transporter 2
Ensembl ID ENSP00000334223
Symbol PAT2 TRAMD1 PAT2 TRAMD1
FamilyBelongs to the amino acid/polyamine transporter 2 family.
Sequence
MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPFMDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAVNSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLVIIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILSLGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYVPAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTTFVR
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp462200SLC36A2solute carrier family 36 member 29598VGNC:13590OMA, EggNOG
Mouse246049Slc36a2solute carrier family 36 (proton/amino acid symporter), member 210090MGI:1891430Inparanoid, OMA, EggNOG
Rat246235Slc36a2solute carrier family 36 member 210116RGD:620492Inparanoid, OMA, EggNOG
Dog489174SLC36A2solute carrier family 36 member 29615VGNC:46383Inparanoid, OMA
Horse100071541SLC36A2solute carrier family 36 member 29796VGNC:23181Inparanoid, OMA
Cow509629SLC36A2solute carrier family 36 member 29913VGNC:34839Inparanoid, OMA
Zebrafish559308slc36a1solute carrier family 36 (proton/amino acid symporter), member 17955ZDB-GENE-061117-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transporter    /    amino acid transporter    /    Proton-coupled amino acid transporter 2
DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC36 family of proton-coupled amino acid transporters    /    Proton-coupled amino acid transporter 2

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.