🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

S100B

설명Protein S100-B

Gene and Protein Information

Gene ID6285
Uniprot Accession IDs P04271 D3DSN6
Ensembl ID ENSP00000291700
Symbol NEF S100 S100-B S100beta
FamilyBelongs to the S-100 family.
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp474141S100BS100 calcium binding protein B9598VGNC:1125OMA, EggNOG
Macaque708117S100BS100 calcium binding protein B9544Inparanoid, OMA, EggNOG
Mouse20203S100bS100 protein, beta polypeptide, neural10090MGI:98217Inparanoid, OMA, EggNOG
Rat25742S100bS100 calcium binding protein B10116RGD:3615Inparanoid, OMA, EggNOG
Dog491615S100BS100 calcium binding protein B9615VGNC:49642Inparanoid, OMA, EggNOG
Horse100054841S100BS100 calcium binding protein B9796VGNC:22656Inparanoid, OMA, EggNOG
Cow525716S100BS100 calcium binding protein B9913VGNC:34248Inparanoid, OMA, EggNOG
Pig100623510S100BS100 calcium binding protein B9823OMA, EggNOG
PlatypusS100BS100 calcium binding protein B [Source:HGNC Symbol;Acc:HGNC:10500]9258OMA, EggNOG
Chicken424038S100BS100 calcium binding protein B9031CGNC:4668Inparanoid, OMA, EggNOG
Zebrafish436825s100bS100 calcium binding protein, beta (neural)7955ZDB-GENE-040718-290Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-B
protein    /    calcium-binding protein    /    signaling molecule    /    Protein S100-B
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-B

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.