| 설명 | Sodium- and chloride-dependent betaine transporter |
|---|
Gene and Protein Information
| Gene ID | 6539 |
|---|---|
| Uniprot Accession IDs | P48065 A0AV52 B2R992 D3DUN8 |
| Ensembl ID | ENSP00000399136 |
| Symbol | BGT1 GAT2 BGT-1 |
| Family | Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A12 subfamily. |
| Sequence | MDGKVAVQECGPPAVSWVPEEGEKLDQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHCTDFLNHSGAGTVTPFENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGRRELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADRFYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467192 | SLC6A12 | solute carrier family 6 member 12 | 9598 | VGNC:8546 | OMA, EggNOG |
| Mouse | 14411 | Slc6a12 | solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 | 10090 | MGI:95628 | Inparanoid, OMA, EggNOG |
| Rat | 50676 | Slc6a12 | solute carrier family 6 member 12 | 10116 | RGD:620255 | Inparanoid, OMA, EggNOG |
| Dog | 404013 | SLC6A12 | solute carrier family 6 member 12 | 9615 | VGNC:46455 | Inparanoid, OMA, EggNOG |
| Cow | 514339 | SLC6A12 | solute carrier family 6 member 12 | 9913 | VGNC:34915 | Inparanoid, OMA, EggNOG |
| Pig | 100512716 | SLC6A12 | solute carrier family 6 member 12 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100016965 | SLC6A12 | solute carrier family 6 member 12 | 13616 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transporter / cation transporter / Sodium- and chloride-dependent betaine transporter
protein / transporter / cation transporter / Sodium- and chloride-dependent betaine transporter
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC6 neurotransmitter transporter family / GABA transporter subfamily / Sodium- and chloride-dependent betaine transporter
protein / Transporter / SLC superfamily of solute carriers / SLC6 neurotransmitter transporter family / GABA transporter subfamily / Sodium- and chloride-dependent betaine transporter
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.