🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

GHRHR

설명Growth hormone-releasing hormone receptor

Gene and Protein Information

Gene ID2692
Uniprot Accession IDs Q02643 Q99863 GHRH receptor
Ensembl ID ENSP00000320180
Symbol GRFR GHRFR IGHD4 IGHD1B
FamilyBelongs to the G-protein coupled receptor 2 family.
Sequence
MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVFLKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRRAFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPLELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLTSMC
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp463331GHRHRgrowth hormone releasing hormone receptor9598VGNC:4368OMA, EggNOG
Macaque696430GHRHRgrowth hormone releasing hormone receptor9544OMA, EggNOG
Mouse14602Ghrhrgrowth hormone releasing hormone receptor10090MGI:95710Inparanoid, OMA, EggNOG
Rat25321Ghrhrgrowth hormone releasing hormone receptor10116RGD:2688Inparanoid, OMA, EggNOG
Dog482385GHRHRgrowth hormone releasing hormone receptor9615VGNC:41208Inparanoid, OMA, EggNOG
Horse100069933GHRHRgrowth hormone releasing hormone receptor9796VGNC:18334Inparanoid, OMA, EggNOG
Cow281782GHRHRgrowth hormone releasing hormone receptor9913VGNC:29350Inparanoid, OMA, EggNOG
Pig397100GHRHRgrowth hormone releasing hormone receptor9823Inparanoid, OMA, EggNOG
OpossumGHRHRgrowth hormone releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4266]13616Inparanoid, OMA, EggNOG
Chicken420385GHRHRgrowth hormone releasing hormone receptor9031CGNC:51246Inparanoid, OMA, EggNOG
Anole lizard100563734ghrhrgrowth hormone releasing hormone receptor28377Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class B secretin like    /    Glucagon receptor    /    Growth hormone-releasing hormone receptor

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.