🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS CoA Structure
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

HDAC2

설명Histone deacetylase 2

Gene and Protein Information

Gene ID3066
Uniprot Accession IDs Q92769 B3KRS5 B4DL58 E1P561 Q5SRI8 Q5SZ86 Q8NEH4 HD2
Ensembl ID ENSP00000430432
Symbol HD2 RPD3 YAF1 KDAC2
FamilyBelongs to the histone deacetylase family. HD type 1 subfamily.
Sequence
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp462950HDAC2histone deacetylase 29598VGNC:11094OMA, EggNOG
Mouse15182Hdac2histone deacetylase 210090MGI:1097691Inparanoid, OMA
Rat84577Hdac2histone deacetylase 210116RGD:619976Inparanoid, OMA
Dog475035HDAC2histone deacetylase 29615VGNC:49101Inparanoid, OMA
Horse100072578HDAC2histone deacetylase 29796VGNC:51036Inparanoid, OMA
Cow407223HDAC2histone deacetylase 29913VGNC:50610Inparanoid, OMA
Opossum100022756HDAC2histone deacetylase 213616Inparanoid, OMA
Chicken395635HDAC2histone deacetylase 29031CGNC:11140Inparanoid, OMA
Anole lizard100566341hdac2histone deacetylase 228377Inparanoid, OMA
Xenopus447995hdac2histone deacetylase 28364XB-GENE-485807Inparanoid, OMA
C. elegans179959hda-1Histone deacetylase 16239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    deacetylase    /    Histone deacetylase 2
protein    /    hydrolase    /    reductase    /    Histone deacetylase 2
protein    /    hydrolase    /    nucleic acid binding    /    Histone deacetylase 2
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class I    /    Histone deacetylase 2

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.