| 설명 | Eukaryotic translation initiation factor 1A, Y-chromosomal |
|---|
Gene and Protein Information
| Gene ID | 9086 |
|---|---|
| Uniprot Accession IDs | O14602 Q9BS77 eIF-1A Y isoform |
| Symbol | eIF-4C |
| Family | Belongs to the eIF-1A family. |
| Sequence | MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 449499 | EIF1AY | eukaryotic translation initiation factor 1A, Y-linked | 9598 | Inparanoid, OMA | |
| S.cerevisiae | 855302 | TIF11 | Tif11p | 4932 | S000004873 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 1A, Y-chromosomal
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 1A, Y-chromosomal
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 1A, Y-chromosomal
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 1A, Y-chromosomal
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.