🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

JUN

설명Transcription factor AP-1

Gene and Protein Information

Gene ID3725
Uniprot Accession IDs P05412 Q6FHM7 Q96G93
Ensembl ID ENSP00000360266
Symbol AP1 p39 AP-1 c-Jun
FamilyBelongs to the bZIP family. Jun subfamily.
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Mouse16476Junjun proto-oncogene10090MGI:96646Inparanoid, OMA
Rat24516JunJun proto-oncogene, AP-1 transcription factor subunit10116RGD:2943Inparanoid, OMA, EggNOG
Dog609429JUNJun proto-oncogene, AP-1 transcription factor subunit9615VGNC:42197Inparanoid, OMA, EggNOG
Cow280831JUNJun proto-oncogene, AP-1 transcription factor subunit9913VGNC:30386Inparanoid, OMA, EggNOG
Opossum100018774JUNJun proto-oncogene, AP-1 transcription factor subunit13616Inparanoid, OMA
Chicken424673JUNJun proto-oncogene, AP-1 transcription factor subunit9031CGNC:52234Inparanoid, OMA, EggNOG
Anole lizard100567718junJun proto-oncogene, AP-1 transcription factor subunit28377Inparanoid, OMA, EggNOG
Xenopus100493911junjun proto-oncogene8364XB-GENE-482228Inparanoid, OMA, EggNOG
Zebrafish335916junJun proto-oncogene, AP-1 transcription factor subunit7955ZDB-GENE-030131-7859Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    basic leucine zipper transcription factor    /    Transcription factor AP-1
protein    /    transcription factor    /    nucleic acid binding    /    Transcription factor AP-1
DTO Classes
protein    /    Transcription factor    /    Basic leucine zipper transcription factor    /    Transcription factor AP-1

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.