🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

SMYD2

설명N-lysine methyltransferase SMYD2

Gene and Protein Information

Gene ID56950
Uniprot Accession IDs Q9NRG4 B2R9P9 I6L9H7 Q4V765 Q5VSH9 Q96AI4
Ensembl ID ENSP00000355924
Symbol KMT3C KMT3C HSKM-B ZMYND14
FamilyBelongs to the class V-like SAM-binding methyltransferase superfamily.
Sequence
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp457729SMYD2SET and MYND domain containing 29598VGNC:1558OMA, EggNOG
Macaque709375SMYD2SET and MYND domain containing 29544Inparanoid, OMA, EggNOG
Mouse226830Smyd2SET and MYND domain containing 210090MGI:1915889Inparanoid, OMA, EggNOG
Rat289372Smyd2SET and MYND domain containing 210116RGD:727785Inparanoid, OMA, EggNOG
Dog480026SMYD2SET and MYND domain containing 29615VGNC:53836Inparanoid, OMA, EggNOG
Horse100052774SMYD2SET and MYND domain containing 29796VGNC:23367Inparanoid, OMA, EggNOG
Cow615229SMYD2SET and MYND domain containing 29913VGNC:35043Inparanoid, OMA, EggNOG
Pig100294706SMYD2SET and MYND domain containing 29823Inparanoid, OMA, EggNOG
Opossum100023305SMYD2SET and MYND domain containing 213616Inparanoid, OMA, EggNOG
Platypus100079176SMYD2SET and MYND domain containing 29258Inparanoid, OMA, EggNOG
Chicken421361SMYD2SET and MYND domain containing 29031CGNC:7436Inparanoid, OMA, EggNOG
Anole lizard100557667smyd2SET and MYND domain containing 228377Inparanoid, OMA, EggNOG
Zebrafish541423smyd2aSET and MYND domain containing 2a7955ZDB-GENE-050320-126Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    transcription cofactor    /    N-lysine methyltransferase SMYD2
DTO Classes
protein    /    Epigenetic regulator    /    Writer    /    Protein methyltransferase    /    SET domain    /    N-lysine methyltransferase SMYD2

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 사양Species reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.