🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

S100A10

설명Protein S100-A10

Gene and Protein Information

Gene ID6281
Uniprot Accession IDs P60903 A8K4V8 P08206 Q5T1C5
Ensembl ID ENSP00000357801
Symbol ANX2LG CAL1L CLP11 42C P11 p10 GP11 ANX2L CAL1L CLP11 Ca[1] ANX2LG
FamilyBelongs to the S-100 family.
Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp457306S100A10S100 calcium binding protein A109598VGNC:1522OMA, EggNOG
Mouse20194S100a10S100 calcium binding protein A10 (calpactin)10090MGI:1339468Inparanoid, OMA, EggNOG
Rat81778S100a10S100 calcium binding protein A1010116RGD:628655Inparanoid, OMA
Dog475851S100A10S100 calcium binding protein A109615Inparanoid, OMA
Horse100034012S100A10S100 calcium binding protein A109796VGNC:22646Inparanoid, OMA, EggNOG
Cow282466S100A10S100 calcium binding protein A109913VGNC:34237Inparanoid, OMA, EggNOG
Pig100515138S100A10S100 calcium binding protein A109823OMA, EggNOG
Opossum100016292S100A10S100 calcium binding protein A1013616OMA, EggNOG
Anole lizard100564227s100a10S100 calcium binding protein A1028377Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-A10
protein    /    calcium-binding protein    /    signaling molecule    /    Protein S100-A10
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-A10

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 사양Species reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.