🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS CoA Structure
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

GPX4

설명Phospholipid hydroperoxide glutathione peroxidase

Gene and Protein Information

Gene ID2879
Uniprot Accession IDs P36969 O43381 Q6PJ59 Q9UPK2 PHGPx
Ensembl ID ENSP00000346103
Symbol MCSP SMDS GPx-4 PHGPx snGPx GSHPx-4 snPHGPx
FamilyBelongs to the glutathione peroxidase family.
Sequence
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp741876GPX4glutathione peroxidase 49598VGNC:2549Inparanoid, OMA, EggNOG
Mouse625249Gpx4glutathione peroxidase 410090MGI:104767Inparanoid, OMA, EggNOG
Rat29328Gpx4glutathione peroxidase 410116RGD:69226Inparanoid, OMA, EggNOG
Zebrafish352928gpx4aglutathione peroxidase 4a7955ZDB-GENE-030410-2Inparanoid, OMA
C. elegans187630gpx-2Glutathione peroxidase6239Inparanoid, OMA
Fruitfly38413PHGPxCG12013 gene product from transcript CG12013-RC7227FBgn0035438Inparanoid, EggNOG
S.cerevisiae852546GPX2glutathione peroxidase GPX24932S000000448OMA, EggNOG
S.cerevisiae853842GPX1glutathione peroxidase GPX14932S000001509Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    peroxidase    /    Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Peroxidase    /    Phospholipid hydroperoxide glutathione peroxidase, mitochondrial

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.