🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

TAS2R41

설명Taste receptor type 2 member 41

Gene and Protein Information

Gene ID259287
Uniprot Accession IDs P59536 P59550 Q495I2 Q50KJ5 Q50KJ6 Q50KJ7 Q645W7 T2R41
Ensembl ID ENSP00000386201
Symbol T2R41 T2R59
FamilyBelongs to the G-protein coupled receptor T2R family.
Sequence
MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQLVGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFLWLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYYFPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFLILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLLARGFWVA
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp472562TAS2R41taste 2 receptor member 419598VGNC:8775Inparanoid, OMA, EggNOG
Mouse387353Tas2r126taste receptor, type 2, member 12610090MGI:2681273Inparanoid, OMA, EggNOG
Rat246219Tas2r126taste receptor, type 2, member 12610116RGD:727853Inparanoid, OMA, EggNOG
Dog482734TAS2R41taste 2 receptor member 419615VGNC:49729Inparanoid, OMA, EggNOG
Pig100524003TAS2R41taste 2 receptor member 419823OMA, EggNOG
Opossum664677T2R41bitter taste receptor Modo-T2R4113616Inparanoid, OMA, EggNOG
Xenopus100335065t2r13bitter taste receptor 138364OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Taste 2 receptor    /    Taste receptor type 2 member 41

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 사양Species reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.