| 설명 | Trace amine-associated receptor 5 |
|---|
Gene and Protein Information
| Gene ID | 9038 |
|---|---|
| Uniprot Accession IDs | O14804 D8KZS1 Q2M1V1 Q4VBL1 Q5VUQ3 Q6NTA8 TaR-5 |
| Ensembl ID | ENSP00000258034 |
| Symbol | PNR PNR |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSACNPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472128 | TAAR5 | trace amine associated receptor 5 | 9598 | VGNC:3719 | Inparanoid, OMA, EggNOG |
| Macaque | 709325 | TAAR5 | trace amine associated receptor 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 215854 | Taar5 | trace amine-associated receptor 5 | 10090 | MGI:2685073 | Inparanoid, OMA, EggNOG |
| Rat | 294123 | Taar5 | trace amine-associated receptor 5 | 10116 | RGD:1359185 | Inparanoid, OMA, EggNOG |
| Dog | 483989 | TAAR5 | trace amine associated receptor 5 | 9615 | VGNC:47059 | Inparanoid, OMA, EggNOG |
| Horse | 100073122 | TAAR5 | trace amine-associated receptor 5 | 9796 | OMA, EggNOG | |
| Horse | 100073108 | LOC100073108 | trace amine-associated receptor 5-like | 9796 | Inparanoid, OMA | |
| Cow | 509368 | TAAR5 | trace amine associated receptor 5 | 9913 | VGNC:35554 | Inparanoid, OMA, EggNOG |
| Pig | 100152802 | TAAR5 | trace amine associated receptor 5 | 9823 | OMA, EggNOG | |
| Opossum | 100031228 | TAAR5 | trace amine associated receptor 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 768558 | TAAR5 | trace amine associated receptor 5 | 9031 | CGNC:10461 | Inparanoid, OMA |
| Anole lizard | 100553785 | taar5 | trace amine associated receptor 5 | 28377 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 5
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 5
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.