Explore small molecules, screening libraries, and tool compounds for discovery research. Browse by target, pathway, or ligand family to quickly find inhibitors, agonists, and chemical probes, with searchable structure/CAS data and supporting documents (SDS/COA where available).
Targets & Pathways
Shop by category
Ready-to-screen compound libraries and focused sets for hit discovery. Browse libraries by target class, pathway, scaffold, or application, and review size, format, and compound information to build screening panels.Customize Your Screening Library to choose compounds, format, and volume, and we’ll prepare a ready-to-use set for you.Customize Your Screening Library
Ligand families
24,639Navigate small molecules by ligand family or scaffold to build focused sets and explore structure–activity relationships. This category groups related chemotypes, helping you select analogs, fragments, and tool molecules for discovery research.
ADC-focused building blocks and tools to support antibody–drug conjugate research. Explore payloads, linkers, conjugation reagents, and related small-molecule components (where available) for designing and evaluating ADC constructs.
PROTAC
2,815PROTAC and targeted protein degradation tools for discovery research. Browse degrader-related ligands, linkers, and building blocks (where available) to assemble or screen PROTAC designs, with clear identifiers for efficient selection.
By Signaling Pathways
102,615Explore pathway-focused tool compounds to study and modulate key signaling cascades. Browse small molecules grouped by signaling pathway to support mechanism studies, phenotypic assays, and target validation, with clear identifiers for fast searching.
By Target (DTO)
19,694Find bioactive small molecules organized by protein target (DTO). Quickly locate tool compounds for specific targets and compare identifiers such as structure, CAS, and synonyms—plus supporting documents —to build screening and validation sets.
By Disease (DOID)
8,779Shop small molecules and tool compounds organized by disease area (DOID). Discover chemical probes, libraries, and related products mapped to therapeutic areas to help assemble compound sets for screening, pathway exploration, and model studies.
Products
- Cbz-Ala-Ala-Asn TFACAS: 499969-23-2(free basis) Formula: C20H25F3N4O9 Molecular Weight: 522.43● In Stock — US warehouse, ships to EU* Item #: C659169View ProductPricing & Pack Sizes
Technical Identifiers
- DP-C-4Formula: C72H78ClF2N15O14 Molecular Weight: 1450.93◐ Made to order · 8–12 wks Item #: D659219View ProductPricing & Pack Sizes
Technical Identifiers
- Seladelpar sodium saltFormula: C21H22F3NaO5S Molecular Weight: 466.45◐ Made to order · 8–12 wks Item #: S659166View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- O=C(O[Na])COC1=CC=C(SC[C@H](OCC)COC2=CC=C(C(F)(F)F)C=C2)C=C1C
- DD-03-156Formula: C53H62F3N9O8S3 Molecular Weight: 1106.31◐ Made to order · 8–12 wks Item #: D659184View ProductPricing & Pack Sizes
Technical Identifiers
- GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPSMolecular Weight: 3850.31◐ Made to order · 8–12 wks Item #: G659225View ProductPricing & Pack Sizes
Technical Identifiers
- N-CBZ-Phe-Arg-AMC TFAFormula: C35H37F3N6O8 Molecular Weight: 726.7◐ Made to order · 8–12 wks Item #: N659175View ProductPricing & Pack Sizes
Technical Identifiers
- hsa-miR-140-5p mimicMolecular Weight: 14067.4◐ Made to order · 8–12 wks Item #: H659172View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- [hsa-miR-140-5p mimic]
- PROTAC BRD4 Degrader-8Formula: C53H61F2N9O11S2 Molecular Weight: 1102.23◐ Made to order · 8–12 wks Item #: P659242View ProductPricing & Pack Sizes
Technical Identifiers
- VU0453379 hydrochlorideFormula: C26H35ClN4O2 Molecular Weight: 471.03◐ Made to order · 8–12 wks Item #: V659164View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- O=C(NC[C@H]1N(CCC1)C(C)C)C(C2=C3N(C4=C2C=CC=C4)C)=CN(C3=O)C5CCCC5.[H]Cl
- hsa-miR-155-5p mimicMolecular Weight: 15276.1◐ Made to order · 8–12 wks Item #: H659241View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- [hsa-miR-155-5p mimic]
- Angiotensin I/II (1-6) (TFA)Formula: C38H56F3N11O12 Molecular Weight: 915.91◐ Made to order · 8–12 wks Item #: A659159View ProductPricing & Pack Sizes
Technical Identifiers
- N-Acetyl-Ser-Asp-Lys-Pro TFACAS: 127103-11-1(free base) Formula: C20H33N5O9(free base) Molecular Weight: 487.5(free base)● In Stock — US warehouse, ships to EU* Item #: N659234View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- Ac-SDKP TFA
Fast Shipping Same-day shipping on in-stock items
Technical Details Quality & specification info on every product page
Pack Size Options Multiple packaging sizes with pricing access from listing
R&D Use Only Products supplied for research and development use
Frequently Asked Questions
What does the By Target/Pathway/Disease listing cover?
It groups compounds associated with targets in By Target/Pathway/Disease, organised so you can move from the pathway to an individual target and then to a specific chemotype. Each entry carries structure, CAS number, and reported activity.
How is By Target/Pathway/Disease organised?
By Target/Pathway/Disease is broken down into Compound Libraries, PROTACs, molecular glues and other degraders and Antibody-drug Conjugates(ADC). Compounds acting on more than one node appear under each relevant target.
How do I choose compounds for By Target/Pathway/Disease research?
For By Target/Pathway/Disease, pick a well-characterised reference compound for the node you want to perturb, and pair it with a structurally unrelated compound hitting the same target — that is the cleanest way to separate pathway effects from off-target ones. Check potency, selectivity, and cell permeability against your assay format. All products are supplied for professional research and development use only, and are not for use in humans, animals, diagnostics, or therapy.
How do I find a specific compound within By Target/Pathway/Disease?
Search By Target/Pathway/Disease by compound name, CAS number, or SMILES, or drill down through the target listing. Unlisted compounds and bulk quantities: [email protected]. We supply verified businesses, research institutions, universities, and government agencies.