Explore small molecules, screening libraries, and tool compounds for discovery research. Browse by target, pathway, or ligand family to quickly find inhibitors, agonists, and chemical probes, with searchable structure/CAS data and supporting documents (SDS/COA where available).
Targets & Pathways
Shop by category
Ready-to-screen compound libraries and focused sets for hit discovery. Browse libraries by target class, pathway, scaffold, or application, and review size, format, and compound information to build screening panels.Customize Your Screening Library to choose compounds, format, and volume, and we’ll prepare a ready-to-use set for you.Customize Your Screening Library
Ligand families
24,639Navigate small molecules by ligand family or scaffold to build focused sets and explore structure–activity relationships. This category groups related chemotypes, helping you select analogs, fragments, and tool molecules for discovery research.
ADC-focused building blocks and tools to support antibody–drug conjugate research. Explore payloads, linkers, conjugation reagents, and related small-molecule components (where available) for designing and evaluating ADC constructs.
PROTAC
2,815PROTAC and targeted protein degradation tools for discovery research. Browse degrader-related ligands, linkers, and building blocks (where available) to assemble or screen PROTAC designs, with clear identifiers for efficient selection.
By Signaling Pathways
102,615Explore pathway-focused tool compounds to study and modulate key signaling cascades. Browse small molecules grouped by signaling pathway to support mechanism studies, phenotypic assays, and target validation, with clear identifiers for fast searching.
By Target (DTO)
19,694Find bioactive small molecules organized by protein target (DTO). Quickly locate tool compounds for specific targets and compare identifiers such as structure, CAS, and synonyms—plus supporting documents —to build screening and validation sets.
By Disease (DOID)
8,779Shop small molecules and tool compounds organized by disease area (DOID). Discover chemical probes, libraries, and related products mapped to therapeutic areas to help assemble compound sets for screening, pathway exploration, and model studies.
Products
- Pepstatin AmmoniumFormula: C34H66N6O9 Molecular Weight: 702.92● In Stock — US warehouse, ships to EU* Item #: P659366View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- Pepstatin A Ammonium
- FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPSMolecular Weight: 3692.15◐ Made to order · 8–12 wks Item #: F659374View ProductPricing & Pack Sizes
Technical Identifiers
- PGlu-3-methyl-His-Pro-NH2 TFAFormula: C19H25F3N6O6 Molecular Weight: 490.43◐ Made to order · 8–12 wks Item #: P659370View ProductPricing & Pack Sizes
Technical Identifiers
- Spinorphin TFAFormula: C47H65F3N8O12 Molecular Weight: 991.06◐ Made to order · 8–12 wks Item #: S659391View ProductPricing & Pack Sizes
Technical Identifiers
- Human growth hormone-releasing factor TFACAS: 83930-13-6(free base) Formula: C215H358N72O66S.xC2HF3O2 Molecular Weight: 5039.65(free base)Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥95%● In Stock — US warehouse, ships to EU* Item #: H659386View ProductPricing & Pack Sizes
Technical Identifiers
- Synonyms
- Growth Hormone Releasing Factor human TFA|Somatorelin (1-44) amide (human) (TFA)
- Anatabine dicitrateFormula: C22H28N2O14 Molecular Weight: 544.46◐ Made to order · 8–12 wks Item #: A659426View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- O=C(CC(C(O)=O)(O)CC(O)=O)O.O=C(CC(C(O)=O)(O)CC(O)=O)O.[C@@H]1(C2=CC=CN=C2)CC=CCN1
- MCL-1/BCL-2-IN-1Formula: C31H27BrN2O3S Molecular Weight: 587.53◐ Made to order · 8–12 wks Item #: M659432View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- O=C(N(CCNC(C1=CC=C(C(C)(C)C)C=C1)=O)C2=O)C3=CC=C(SC4=CC=C(Br)C=C4)C5=C3C2=CC=C5
- DYRK1-IN-1Formula: C12H12N6 Molecular Weight: 240.26◐ Made to order · 8–12 wks Item #: D659448View ProductPricing & Pack Sizes
Technical Identifiers
- HDAC10-IN-1Formula: C18H23N3O2 Molecular Weight: 313.39◐ Made to order · 8–12 wks Item #: H659351View ProductPricing & Pack Sizes
Technical Identifiers
- SM-164 HydrochlorideFormula: C62H85ClN14O6 Molecular Weight: 1157.88◐ Made to order · 8–12 wks Item #: S659347View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- show more
- Human IgG1 kappa, Isotype Control◐ Made to order · 8–12 wks Item #: H659431View ProductPricing & Pack Sizes
Technical Identifiers
- SMILES
- [Human IgG1 kappa, Isotype Control]
- GIP (1-30) amide, porcine TFAFormula: C164H246F3N41O49S Molecular Weight: 3665.02◐ Made to order · 8–12 wks Item #: G659430View ProductPricing & Pack Sizes
Technical Identifiers
Fast Shipping Same-day shipping on in-stock items
Technical Details Quality & specification info on every product page
Pack Size Options Multiple packaging sizes with pricing access from listing
R&D Use Only Products supplied for research and development use
Frequently Asked Questions
What does the By Target/Pathway/Disease listing cover?
It groups compounds associated with targets in By Target/Pathway/Disease, organised so you can move from the pathway to an individual target and then to a specific chemotype. Each entry carries structure, CAS number, and reported activity.
How is By Target/Pathway/Disease organised?
By Target/Pathway/Disease is broken down into Compound Libraries, PROTACs, molecular glues and other degraders and Antibody-drug Conjugates(ADC). Compounds acting on more than one node appear under each relevant target.
How do I choose compounds for By Target/Pathway/Disease research?
For By Target/Pathway/Disease, pick a well-characterised reference compound for the node you want to perturb, and pair it with a structurally unrelated compound hitting the same target — that is the cleanest way to separate pathway effects from off-target ones. Check potency, selectivity, and cell permeability against your assay format. All products are supplied for professional research and development use only, and are not for use in humans, animals, diagnostics, or therapy.
How do I find a specific compound within By Target/Pathway/Disease?
Search By Target/Pathway/Disease by compound name, CAS number, or SMILES, or drill down through the target listing. Unlisted compounds and bulk quantities: [email protected]. We supply verified businesses, research institutions, universities, and government agencies.