Recombinant Human TNF-α Protein

Cat. No.: rp228983
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
P01375
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The ED50 for this effect is typically 0.075 ng/mL.
Size
Alemania (EU)
USA*
Price
Qty
10μg
rp228983-10μg
5 Disponible
78,01€
50μg
rp228983-50μg
5 Disponible
225,53€
100μg
rp228983-100μg
5 Disponible
329,65€
1mg
rp228983-1mg
Fabricado bajo pedido · 8–12 semanas
1.735,39€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human TNF-α Protein
Sinónimos
APC1 | APC1 protein | Cachectin | DIF | Differentiation inducing factor | Macrophage cytotoxic factor | Tnf | TNF superfamily member 2 | TNF superfamily, member 2 | TNF, macrophage derived | TNF, monocyte derived | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN |
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE),See COA
Mecanismos bioquímicos y fisiológicos
Tumor necrosis factor alpha (TNF-alpha), also known as cachectin and TNFSF2, is the prototypic ligand of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, immune system development, apoptosis, and lipid metabolis
Bioactividad
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The ED50 for this effect is typically 0.075 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
78-233 aa
Secuencia
MGSSHHHHHHSSGLVPRGSHMRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Número de adhesión
Peso molecular previsto
19.5 kDa
SDS-PAGE
18.3 kDa, under reducing conditions;18.3 & 36.4 kDa, under non-reducing condition
Tipo de molécula
Proteína
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human TNF-α Protein (rp228983) - Protein Bioactivity 
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The ED₅₀ for this effect is typically 0.075 ng/mL.
Recombinant Human TNF-α Protein (rp228983) - SDS-PAGE 
3 μg/lane of Recombinant Human TNF-α Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 18.3 kDa under reducing conditions and 18.3 & 36.4 kDa under non-reducing conditions. The observation of protein as both dimers and monomers under non-reducing (NR) conditions suggests that a portion of the protein forms dimers. This dimerization may be mediated by (or stabilized by) disulfide bonds (Uniprot: P01375).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F1129665Certificate of AnalysisSep 06, 2026 rp228983
ZJ25F1129666Certificate of AnalysisSep 06, 2026 rp228983
ZJ25F1129667Certificate of AnalysisSep 06, 2026 rp228983
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.