Streptavidin, CAS No.9013-20-1

CAS: 9013-20-1 Cat. No.: S1522291 Número EC: 618-481-6 PubChem CID: 51062757
Disponible para pedir
GRADE & PURITY BioReagent ? BioReagent grade — tested suitable for life-science and molecular-biology use. Use for cell culture, assays, and biochemical work needing biological compatibility. ≥98%
★
Size
Alemania (EU)
USA*
Price
Qty
1mg
S1522291-1mg
Fabricado bajo pedido · 8–12 semanas
25,95€
5mg
S1522291-5mg
Fabricado bajo pedido · 8–12 semanas
86,69€
25mg
S1522291-25mg
Fabricado bajo pedido · 8–12 semanas
303,62€
100mg
S1522291-100mg
Fabricado bajo pedido · 8–12 semanas
850,30€
250mg
S1522291-250mg
Fabricado bajo pedido · 8–12 semanas
1.735,39€
1g
S1522291-1g
Fabricado bajo pedido · 8–12 semanas
4.946,03€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

BioReagent,≥98% BioReagent for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Argon charged Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 110 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Source:E. coli
Molecular weight:13.3kDa for monomer, 53kDa for tetramer
Accession:P22629 Ala37- Ser163 with an N-terminal Met
Protein amino acid sequence:AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
Purity:≥98% by SDS-PAGE or HPLC
Formulation:Lyophilized in 20 mM potassium phosphate buffer pH 6.5.
Biotin binding activity >17U/mg rSA protein(one unit binds 1µg D-biotin)
Endotoxin level:<0.01EU/ug rSA protein
Advantage:
1)high biotin binding activity
2)no extra amino sequence (tag free)
3)high purity
Product Form: Lyophilized powder, 20 mM potassium phosphate buffer, pH 6.5.
Product Application:
Streptavidin is a biotin-binding protein that was originally isolated from Streptomyces avidinii. Streptavidin is superior to avidin because it has almost no net charge at neutral pH and does not contain carbohydrate and exhibits lower level of non-specific binding. Recombinant streptavidin is a tetrameric protein with a molecular weight of approximately 53kDa, consisting of four subunits of approximately 13kDa. Each subunit contains a single biotin-binding site and has six tyrosine residues. The purified recombinant streptavidin can be applied in detection of biotinylated antibodies and other probes in a variety of standard assay methods, including Western Blotting, ELISA, immunohistochemistry and fluorescence imaging.:
Streptavidin is a biotin-binding protein that was originally isolated from Streptomyces avidinii. Streptavidin is superior to avidin because it has almost no net charge at neutral pH and does not contain carbohydrate and exhibits lower level of non-specific binding. Recombinant streptavidin is a tetrameric protein with a molecular weight of approximately 53kDa, consisting of four subunits of approximately 13kDa. Each subunit contains a single biotin-binding site and has six tyrosine residues. The purified recombinant streptavidin can be applied in detection of biotinylated antibodies and other probes in a variety of standard assay methods, including Western Blotting, ELISA, immunohistochemistry and fluorescence imaging.
Packaging based on protein content

Specifications

Product Name
Streptavidin, CAS No.9013-20-1
Grado
BioReagent
Especificaciones y pureza
BioReagent,≥98%
Mecanismos bioquímicos y fisiológicos
Streptavidin is a biotin binding protein and has the ability to bind four molecules of biotin. The biotin binding pocket of streptavidin helps to interact with biotin. It can be used to enhance protein binding and multimerization.
Conjugación
Unconjugated
CAS
9013-20-1
Tipo de molécula
Proteína
Almacenamiento y envío
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Argon charged
Enviado en
Ice chest + Ice pads

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

9 results found

Lot NumberCertificate TypeFechaArticulo
E2629378Certificate of AnalysisMay 07, 2026 S1522291
E2629410Certificate of AnalysisMay 07, 2026 S1522291
E2629411Certificate of AnalysisMay 07, 2026 S1522291
E2629412Certificate of AnalysisMay 07, 2026 S1522291
E2629413Certificate of AnalysisMay 07, 2026 S1522291
E2629414Certificate of AnalysisMay 07, 2026 S1522291
G2616005Certificate of AnalysisMay 07, 2026 S1522291
G2616006Certificate of AnalysisMay 07, 2026 S1522291
I2622010Certificate of AnalysisMay 07, 2026 S1522291
Preguntas frecuentes y artículos
Citations of This Product
Referencias
1. Si Chen, Rong Fang, Yi Li, Fei Deng, Xing Liu, Danting Yang.  (2023)  CRISPR/Cas12a-powered CLASA towards OTA ultrasensitive detection in cereal samples.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2023.109691]
2. Ye He, Panlin Wang, Zhuzheng Wu, Yating Chen, Xiaohao Gan, Fangjie Li, Wenxiang Wang.  (2023)  Dual-aptamer-based colorimetric assay for the accurate identification of circulating tumor cells via Fe3O4@Pt NP nanozymes and G-quadruplex/hemin for signal amplification.  NEW JOURNAL OF CHEMISTRY,  47  (47): (21654-21660).  [PMID:] [10.1039/D3NJ04466A]
3. Haipeng Cui, Wenwei Pan, Tiechuan Li, Xiaotian Shen, Ye Chang, Wei Pang, Xuexin Duan.  (2023)  Rapid Purification and Enrichment of Viral Particles Using Self-Propelled Micromotors.  Nanoscale,      [PMID:37850316] [10.1039/D3NR02812G]
4. Youxin Qiu, Zhaoying Liu, Yuhao Mao, Weipeng Teng, Ming Li.  (2023)  DNA-bridged double gold nanoparticles-based immunochromatography for dual-mode detection of ochratoxin A.  JOURNAL OF FOOD SCIENCE,  88  (10): (4316-4326).  [PMID:37732469] [10.1111/1750-3841.16763]
5. Huang Lianrun, Wang Guixiu, Wu Yanling, Wang Zhijia, Ding Yuan, Liang Hongwu, Hua Xiude.  (2023)  Development of competitive and noncompetitive lateral flow immunoassays for pendimethalin using synthetic peptides.  MICROCHIMICA ACTA,  191  (1): (1-11).  [PMID:38159155] [10.1007/s00604-023-06151-w]
6. Yuxiu Fan, Dong Li, Xiaoyi Xie, Yi Zhang, Ling Jiang, Bin Huang, Xiupei Yang.  (2023)  Flower-like L-Cys-FeNiNPs nanozyme aptasensor for sensitive colorimetric detection of aflatoxin B1.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2023.109842]
7. Yuan Shun, Che Yanjia, Wang Zhiwei, Xing Kai, Xie Xiaoping, Chen Yuanyang.  (2023)  Mitochondrion-targeted carboxymethyl chitosan hybrid nanoparticles loaded with Coenzyme Q10 protect cardiac grafts against cold ischaemia‒reperfusion injury in heart transplantation.  Journal of Translational Medicine,  21  (1): (1-23).  [PMID:38124174] [10.1186/s12967-023-04763-7]
8. Wei Liu, Hongmei Nie, He Li, Ya Liu, Maoye Tian, Shuhuai Wang, Yuwei Yang, Wei Long.  (2023)  Engineered platelet cell motors for boosted cancer radiosensitization.  JOURNAL OF COLLOID AND INTERFACE SCIENCE,      [PMID:38128197] [10.1016/j.jcis.2023.12.091]
9. Wenwei Pan, Ziyu Han, Ye Chang, Xu Yan, Feng Zhou, Sihong Shen, Xuexin Duan.  (2023)  Rational design of multivalent biosensor surfaces to enhance viral particle capture.  Journal of Materials Chemistry B,  11  (20): (4511-4522).  [PMID:37161578] [10.1039/D2TB02828J]
10. Minxin Mao, Fengxia Sun, Jun Wang, Xiuping Li, Qiuli Pan, Chifang Peng, Zhouping Wang.  (2023)  Delayed delivery of chromogenic substrate to nanozyme amplified aptamer lateral flow assay for acetamiprid.  SENSORS AND ACTUATORS B-CHEMICAL,      [PMID:] [10.1016/j.snb.2023.133720]
11. Wenwei Pan, Rui You, Shuaihua Zhang, Ye Chang, Feng Zhou, Quanning Li, Xuejiao Chen, Xuexin Duan, Ziyu Han.  (2023)  Tunable nanochannel resistive pulse sensing device using a novel multi-module self-assembly.  ANALYTICA CHIMICA ACTA,      [PMID:36925301] [10.1016/j.aca.2023.341035]
12. Ying Gao, Jie Zhang, Jiexia Pan, Sanjun Ying, Bang Lou, Qingliang Yang, Weiyong Hong, Gensheng Yang.  (2023)  FOF1-ATP synthase molecular motor biosensor for miRNA detection of colon cancer.  LIFE SCIENCES,      [PMID:36841472] [10.1016/j.lfs.2023.121527]
13. Ke Kang, Yujia Zhang, Xiaoxi Zhou, Yue Yu, Nanhang Zhu, Jia Cheng, Qiangying Yi, Yao Wu.  (2023)  Hybrid Extracellular Vesicles-Liposomes Camouflaged Magnetic Vesicles Cooperating with Bioorthogonal Click Chemistry for High-Efficient Melanoma Circulating Tumor Cells Enrichment.  Advanced Healthcare Materials,      [PMID:36773325] [10.1002/adhm.202202825]
14. Fan Zhang, Hongxia Du, Linsen Li, Tengfei Li, Jing Wang, Zilei Chen, Mengmeng Yan, Chao Zhu, Feng Qu.  (2022)  Enzyme-Linked Aptamer Kits for Rapid, Visual, and Sensitive Determination of Lactoferrin in Dairy Products.  Foods,  11  (23): (3763).  [PMID:36496570] [10.3390/foods11233763]
15. Yan-Jia Che, Xiao-He Ren, Zhi-Wei Wang, Qi Wu, Kai Xing, Min Zhang, Chang Xu, Di Han, Shun Yuan, Si-Hao Zheng, Yuan-Yang Chen, Xin-Ru Liao, Feng Shi, Xiao-Han Zhong, Xin Cai, Si-Xue Cheng.  (2022)  Lymph-Node-Targeted Drug Delivery for Effective Immunomodulation to Prolong the Long-Term Survival After Heart Transplantation.  ADVANCED MATERIALS,  35  (16): (2207227).  [PMID:36314402] [10.1002/adma.202207227]
16. Lijun Wang, Hong Zhou, Haixia Hu, Xue Wu, Wenhao Guo, Yan Liu, Yukun Huang, Xiao Yang, Xianggui Chen.  (2022)  Constructing difunctional histidine-modified magnetic hybrid nanozymes as capture probes and signal amplifiers for the sensitive colorimetric detection of Salmonella Typhimurium in food.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2022.107917]
17. Runxuan Zhang, Tao Liao, Xiao Wang, Hong Zhai, Di Yang, Xin Wang, Haiyan Wang, Feng Feng.  (2022)  Second near-infrared fluorescent dye for lateral flow immunoassays rapid detection of influenza A/B virus.  ANALYTICAL BIOCHEMISTRY,      [PMID:35964731] [10.1016/j.ab.2022.114847]
18. Yishi Li, Dengyong Peng, Shuliang Guo, Bijun Yang, Jing Zhou, Jiaxu Zhou, Qifan Zhang, Lijuan Bai.  (2022)  Aptasensor for Mycobacterium tuberculosis antigen MPT64 detection using anthraquinone derivative confined in ordered mesoporous carbon as a new redox nanoprobe.  BIOELECTROCHEMISTRY,      [PMID:35850057] [10.1016/j.bioelechem.2022.108209]
19. Jiang Chang, Deying Zou, Honglin Ren, Xilin Liu, Meng Li, Zhaozhao Si, Cheng Han, Zengshan Liu, Shiying Lu, Pan Hu.  (2022)  An ultrasensitive and long-lasting chemiluminescence immunoassay for IP-10 detection based on a 4-bromophenol-reinforced bienzymatic system.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2022.107719]
20. Jing Le, Xie Chong-Yu, Li Qian-Qian, Yao Hui-Fang, Yang Mei-Qing, Li Hui, Xia Fan, Li Shao-Guang.  (2022)  A Sandwich-type Lateral Flow Strip Using a Split, Single Aptamer for Point-of-Care Detection of Cocaine.  Journal of Analysis and Testing,  6  (2): (120-128).  [PMID:] [10.1007/s41664-022-00228-w]
21. He Chen, Yuan Ding, Jiao Li, Lianrun Huang, Gualberto González-Sapienza, Bruce D. Hammock, Minghua Wang, Xiude Hua.  (2022)  New Approach to Generate Ratiometric Signals on Immunochromatographic Strips for Small Molecules.  ANALYTICAL CHEMISTRY,      [PMID:35536756] [10.1021/acs.analchem.2c00838]
22. Zhang Baozhong, He Jintao, Tian Panpan, Lv Lina, Zhu Huina, Xie Lingling, Liu Xiaolong, He Baoshan.  (2022)  Ultrasensitive Electrochemical Aptasensor Based on Ag-Cu2O/rGO and CeO2/AuPt Nanocomposites for PCB77 Detection.  JOURNAL OF ELECTRONIC MATERIALS,  51  (7): (3831-3842).  [PMID:] [10.1007/s11664-022-09631-6]
23. Xiaoxi Zhou, Yujia Zhang, Ke Kang, Yanchao Mao, Yue Yu, Qiangying Yi, Yao Wu.  (2022)  Controllable Environment Protein Corona-Disguised Immunomagnetic Beads for High-Performance Circulating Tumor Cell Enrichment.  ANALYTICAL CHEMISTRY,      [PMID:35254814] [10.1021/acs.analchem.1c04587]
24. Yanli Zhu, Jikai Wang, Haitao Xie, Hailing Liu, Shuangquan Liu, Dongxiu He, Pengbing Mi, Suisui He, Jun Wang, Yiyang Sun.  (2022)  NIR-to-Vis Handheld Platforms for Detecting miRNA Level and Mutation Based on Sub-10 nm Sulfide Nanodots and HCR Amplification.  ACS Applied Materials & Interfaces,      [PMID:35188756] [10.1021/acsami.2c00689]
25. Xiaoxi Zhou, Yujia Zhang, Ke Kang, Nanhang Zhu, Jia Cheng, Qiangying Yi, Yao Wu.  (2022)  Artificial cell membrane camouflaged immunomagnetic nanoparticles for enhanced circulating tumor cell isolation.  Journal of Materials Chemistry B,  10  (16): (3119-3125).  [PMID:35348557] [10.1039/D1TB02676C]
26. Hanjun Chen, Ying Liu, Shaoqiong Feng, Yu Cao, Tingting Wu, Zhihong Liu.  (2021)  Cotton thread-based multi-channel photothermal biosensor for simultaneous detection of multiple microRNAs.  BIOSENSORS & BIOELECTRONICS,      [PMID:34968855] [10.1016/j.bios.2021.113913]
27. Zhaode Mu, Jiangman Tian, Jie Wang, Jing Zhou, Lijuan Bai.  (2021)  A new electrochemical aptasensor for ultrasensitive detection of endotoxin using Fe-MOF and AgNPs decorated P-N-CNTs as signal enhanced indicator.  APPLIED SURFACE SCIENCE,      [PMID:] [10.1016/j.apsusc.2021.151601]
28. Zheng Pimiao, Peng Tao, Wang Jianyi, Zhang Jing, Wang Zile, Zhang Yanfang, Ren Zhenhui, Wang Sihan, Jiang Haiyang.  (2021)  Fluorescent lateral flow immunoassay based on gold nanocluster for detection of pyrrolizidine alkaloids.  MICROCHIMICA ACTA,  188  (1): (1-10).  [PMID:33389211] [10.1007/s00604-020-04672-2]
29. Wenwei Pan, Ziyu Han, Ye Chang, Xuexin Duan.  (2020)  Three-dimensional biosensor surface based on novel thorns-like polyelectrolytes.  BIOSENSORS & BIOELECTRONICS,      [PMID:32836090] [10.1016/j.bios.2020.112504]
30. Qiannan Xue, Zheyu Li, Qikun Wang, Wenwei Pan, Ye Chang, Xuexin Duan.  (2020)  Nanostrip flexible microwave enzymatic biosensor for noninvasive epidermal glucose sensing.  Nanoscale Horizons,  5  (6): (934-943).  [PMID:32301449] [10.1039/D0NH00098A]
31. Ming Luo, Shouli Li, Jieshuo Wan, Chenglin Yang, Beidi Chen, Jianguo Guan.  (2020)  Enhanced Propulsion of Urease-Powered Micromotors by Multilayered Assembly of Ureases on Janus Magnetic Microparticles.  LANGMUIR,      [PMID:32023066] [10.1021/acs.langmuir.9b03315]
32. Zhengsong Yu, Na Li, Xiaosong Hu, Yulin Dong, Yawei Lin, Hongwei Cai, Zhizhong Xie, Deyu Qu, Xi Li.  (2019)  Highly efficient electrochemical detection of lead ion using metal-organic framework and graphene as platform based on DNAzyme.  SYNTHETIC METALS,      [PMID:] [10.1016/j.synthmet.2019.06.017]
33. Zhen Zhang, Mengting Zhu, Zichao Chen, Xiaomeng Wang, Guang Chen, Shusheng Zhang.  (2019)  Coaxial sensing bio-amplifier for ultrasensitive detections of circulating tumor DNAs.  BIOSENSORS & BIOELECTRONICS,      [PMID:31195204] [10.1016/j.bios.2019.111414]
34. Sheng Tao, Guo Fanglei, Deng Jingzhe, Yuan Yi, Deng Dawei, Xie Zhuoying.  (2019)  Bifunctional Microbead Carriers with Magnetic Response and Plasmonic Fluorescence Enhancement.  JOURNAL OF NANOSCIENCE AND NANOTECHNOLOGY,  19  (2): (691-696).  [PMID:30360143] [10.1166/jnn.2019.15729]
35. Tao Peng, Jianyi Wang, Sijun Zhao, Yuyang Zeng, Pimiao Zheng, Demei Liang, Ghulam Mujtaba Mari, Haiyang Jiang.  (2018)  Highly luminescent green-emitting Au nanocluster-based multiplex lateral flow immunoassay for ultrasensitive detection of clenbuterol and ractopamine.  ANALYTICA CHIMICA ACTA,      [PMID:30327104] [10.1016/j.aca.2018.08.014]
36. Yang Jiachuan, Yang Qian, Deng Jiaqi, Tao Zhexuan, Hua Xiude, Wang Minghua.  (2018)  Development of immunochromatographic assays for the detection of imidacloprid in soil chemical barrier.  ENVIRONMENTAL SCIENCE AND POLLUTION RESEARCH,  25  (26): (26617-26624).  [PMID:29998448] [10.1007/s11356-018-2707-6]
37. Shengping Wen, Yu Su, Rong Wu, Shiwei Zhou, Qianhao Min, Gao-Chao Fan, Li-Ping Jiang, Rong-Bin Song, Jun-Jie Zhu.  (2018)  Plasmonic Au nanostar Raman probes coupling with highly ordered TiO2/Au nanotube arrays as the reliable SERS sensing platform for chronic myeloid leukemia drug evaluation.  BIOSENSORS & BIOELECTRONICS,      [PMID:29909197] [10.1016/j.bios.2018.06.001]
38. Nana Sun, Yuan Ding, Zhexuan Tao, Hongjie You, Xiude Hua, Minghua Wang.  (2018)  Development of an upconversion fluorescence DNA probe for the detection of acetamiprid by magnetic nanoparticles separation.  FOOD CHEMISTRY,      [PMID:29622212] [10.1016/j.foodchem.2018.02.148]
39. Juan Chen, Zhongming Huang, Hongmin Meng, Lin Zhang, Danyang Ji, Juanzu Liu, Fei Yu, Lingbo Qu, Zhaohui Li.  (2018)  A facile fluorescence lateral flow biosensor for glutathione detection based on quantum dots-MnO2 nanocomposites.  SENSORS AND ACTUATORS B-CHEMICAL,      [PMID:] [10.1016/j.snb.2018.01.101]
40. Qingrui Yang, Shuting Pan, Yuan Zhao, Hao Zhang, Wei Pang, Xuexin Duan.  (2017)  Biomolecular stiffness detection based on positive frequency shift of CMOS compatible gigahertz solidly mounted resonators.  BIOSENSORS & BIOELECTRONICS,      [PMID:28499197] [10.1016/j.bios.2017.05.002]
41. Luyan Sun, Jiaxun Wan, Christian G. Schaefer, Zihao Zhang, Jing Tan, Jia Guo, Limin Wu, Changchun Wang.  (2017)  Specific On-site Assembly of Multifunctional Magnetic Nanocargos Based on Highly Efficient and Parallelized Bioconjugation: Toward Personalized Cancer Targeting Therapy.  ACS Biomaterials Science & Engineering,      [PMID:33465935] [10.1021/acsbiomaterials.6b00773]
42. Ziyu Han, Yanyan Wang, Xuexin Duan.  (2017)  Biofunctional polyelectrolytes assembling on biosensors – A versatile surface coating method for protein detections.  ANALYTICA CHIMICA ACTA,      [PMID:28351633] [10.1016/j.aca.2017.01.051]
43. Yu Zhang, Xiaofeng Zhang, Jinling Zhang, Bin Sun, Lulu Zheng, Jun Li, Sixiu Liu, Guodong Sui, Zhengfeng Yin.  (2016)  Microfluidic chip for isolation of viable circulating tumor cells of hepatocellular carcinoma for their culture and drug sensitivity assay.  CANCER BIOLOGY & THERAPY,      [PMID:27662377] [10.1080/15384047.2016.1235665]
44. Liping Jiang, Faying Li, Jinhui Feng, Ping Wang, Qing Liu, Yueyun Li, Yunhui Dong, Qin Wei.  (2016)  An optionality further amplification of an sandwich-type electrochemical immunosensor based on biotin–streptavidin–biotin strategy for detection of alpha fetoprotein.  RSC Advances,  6  (29): (24373-24380).  [PMID:] [10.1039/C6RA01178K]
45. Nannan Liu, Zekun Yang, Xiaoding Lou, Benmei Wei, Juntao Zhang, Pengcheng Gao, Ruizuo Hou, Fan Xia.  (2015)  Nanopore-Based DNA-Probe Sequence-Evolution Method Unveiling Characteristics of Protein–DNA Binding Phenomena in a Nanoscale Confined Space.  ANALYTICAL CHEMISTRY,      [PMID:25751160] [10.1021/acs.analchem.5b00375]
46. Wang Mo, Yang Zhiqing, Guo Yunlong, Wang Xinxu, Yin Huanshun, Ai Shiyun.  (2014)  Visible-light induced photoelectrochemical biosensor for the detection of microRNA based on Bi2S3 nanorods and streptavidin on an ITO electrode.  MICROCHIMICA ACTA,  182  (1): (241-248).  [PMID:] [10.1007/s00604-014-1324-4]
47. Kang Shao, Jing Wang, Xiaochun Jiang, Feng Shao, Tingting Li, Shiyi Ye, Lu Chen, Heyou Han.  (2014)  Stretch–Stowage–Growth Strategy to Fabricate Tunable Triply-Amplified Electrochemiluminescence Immunosensor for Ultrasensitive Detection of Pseudorabies Virus Antibody.  ANALYTICAL CHEMISTRY,      [PMID:24845014] [10.1021/ac500175y]
48. Shengguo Lu, Fang Luo, Xujia Duan, Chen Jia, Yuwang Han, He Huang.  (2014)  Hybrid polydiacetylene/magnetite nanoparticles: Sensing for sodium cetyltrimethylammonium bromide and streptavidin.  JOURNAL OF APPLIED POLYMER SCIENCE,  131  (16):   [PMID:] [10.1002/app.40634]
49. Yanrong Zhang, Qin Tu, Dong-En Wang, Yun Chen, Bingzhang Lu, Mao-Sen Yuan, Jinyi Wang.  (2013)  Adamantyl-terminated dendronized molecules: synthesis and interaction with β-cyclodextrin-functionalized poly(dimethylsiloxane) interface.  NEW JOURNAL OF CHEMISTRY,  37  (8): (2358-2368).  [PMID:] [10.1039/C3NJ00129F]
50. Yuping Liu, Beibei Zhang, Xueyuan Wu, Fan Wang, Zhiyi Yang, Mengyi Li, Kaixuan Sheng, Yue Yan, Liang Zhu, Hui Jing, Yanmin Wu, Lili Hu, Yanyan Yu, Chenglin Li.  (2025)  A facile liquid biopsy assay for highly efficient CTCs capture and reagent-less monitoring of immune checkpoint PD-L1 expression on CTCs with non-small cell lung cancer patients.  BIOSENSORS & BIOELECTRONICS,      [PMID:39929085] [10.1016/j.bios.2025.117236]
51. Xiaohui Yang, Yixian Li, Josh Zixi Lee, Yuanmin Sun, Xin Tan, Yijie Liu, Yang Yu, Huiqiang Li, Xue Li.  (2024)  A Highly Sensitive Dual-Drive Microfluidic Device for Multiplexed Detection of Respiratory Virus Antigens.  Micromachines,  15  (6): (685).  [PMID:38930655] [10.3390/mi15060685]
52. Ziyang He, Yonghong Meng, Mei Liu.  (2024)  A multicolor aptasensor based on target-induced anti-etching gold nanorod for visible detection of aflatoxin B1.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2024.110659]
53. Yunzhi Zhao, Ying Hao, Min Cui, Na Li, Bao Sun, Yu Wang, Haiyan Zhao, Cong Zhang.  (2024)  An electrochemical biosensor based on DNA tetrahedron nanoprobe for sensitive and selective detection of doxorubicin.  BIOELECTROCHEMISTRY,      [PMID:38271768] [10.1016/j.bioelechem.2024.108652]
54. Jiawei Chen, Gan Zhang, Xiaoyue Xiao, Daofeng Liu, Juan Peng, Yonghua Xiong, Weihua Lai.  (2024)  Bifunctional bovine serum albumin modification driven sensitivity-enhanced lateral flow immunoassay for small molecule hazards monitoring in food.  INTERNATIONAL JOURNAL OF BIOLOGICAL MACROMOLECULES,      [PMID:39476895] [10.1016/j.ijbiomac.2024.136915]
55. Yangyang Li, Riyue Shu, Cheng Zeng, Jing Wang, Lin Zhang, Zhe Tang.  (2025)  Bio-inspired AS1411-Functionalized membrane for specific and non-destructive capture of tumor cells.  JOURNAL OF MEMBRANE SCIENCE,      [PMID:] [10.1016/j.memsci.2025.123833]
56. Danyu Wang, Xin Zhou, Mengyu Huang, Jie Duan, Yue Qiu, Hua Yi, Yang Wang, Huimin Xue, Jiali Zhang, Qiuxia Yang, Hua Gao, Zhenzhen Guo, Kaixiang Zhang.  (2024)  Cascade Enzymes Confined in DNA Nanoanchors for Antitumor Therapy.  ACS Applied Materials & Interfaces,      [PMID:39265065] [10.1021/acsami.4c09835]
57. Huinan Chen, Jingyao Song, Yuanyuan Li, Dongmei Deng, Yuchen Song, Xiaoli Zhu, Liqiang Luo.  (2024)  Cascade signal amplifying strategy for ultrasensitive detection of tumor biomarker by DNAzyme cleaving mediated HCR.  SENSORS AND ACTUATORS B-CHEMICAL,      [PMID:] [10.1016/j.snb.2024.136466]
58. Junqiu Liu, Zhaidong Liu, Chunqin Zhao, Yuting Jiao, Baohong Li, Jiaju Shi, Zichao Chen, Zhen Zhang.  (2024)  Coaxial dual-path electrochemical biosensing and logic strategy-based detection of lung cancer-derived exosomal PD-L1.  Nanoscale,      [PMID:38630023] [10.1039/D4NR00412D]
59. Xia Xu, Xin Liu, Yixing Qiu, Yufan Song, Xuxia Zhou, Yuting Ding.  (2024)  Colorimetric aptasensor based on Fe3O4@MOF@Pt nanozymes for ultrasensitive detection of histamine in fish.  FOOD CONTROL,      [PMID:] [10.1016/j.foodcont.2024.110702]
60. Boyu Yang, Chao Li, Yongshuo Ren, Weichen Wang, Xiangxiang Zhang, Xiaojun Han.  (2024)  Construction of the Glycolysis Metabolic Pathway Inside an Artificial Cell for the Synthesis of Amino Acid and Its Reversible Deformation.  Journal of the American Chemical Society,      [PMID:39042264] [10.1021/jacs.4c06227]
61. Yan Liu, Yujie Li, Chen Shao, Ping Wang, Xiaoxuan Wang, Runhe Li.  (2024)  Curcumin-based residue-free and reusable photodynamic inactivation system for liquid foods and its application in freshly squeezed orange juice.  FOOD CHEMISTRY,      [PMID:38968711] [10.1016/j.foodchem.2024.140316]
62. Qiudi Xu, Ke Liu, Yu He, Lan Wang, Zefan Lu, Zhongxuan Liu, Tao Zhang.  (2024)  Digital microfluidic chip with photopatterned reactive sites for direct biomolecules immobilization and magnetic beads-free immunoassay.  SENSORS AND ACTUATORS B-CHEMICAL,      [PMID:] [10.1016/j.snb.2024.136893]
63. Hang Ao, Wencheng Xiao, Wenrui Hu, Jie Wu, Huangxian Ju.  (2024)  DNA Conformation-Regulated Hemin Switch for Lab-on-Chip Chemiluminescent Detection of an Antibody Secreted from Hybridoma Cells.  ANALYTICAL CHEMISTRY,      [PMID:39503400] [10.1021/acs.analchem.4c04122]
64. Mingxia Lin, Huiyi Yang, Qinglan Li, Huanxin Xiao, Shilin Jiang, Jinhui Liang, Xiping Cui, Suqing Zhao.  (2024)  Dual lateral flow assay based on PdRu nanocages for human Papillomavirus detection.  JOURNAL OF COLLOID AND INTERFACE SCIENCE,      [PMID:38908288] [10.1016/j.jcis.2024.06.002]
65. Rongsheng Hu, Shaowei Lin, Fajun Li, Jiaqing Shen, Yinong Xie, Baichang Deng, Youyu Zhang, Zhaogang Dong, Jinfeng Zhu.  (2024)  Exploring Aptamer-Based Metasurfaces for Label-Free Plasmonic Biosensing of Breast Tumor-Derived Exosomes.  Advanced Optical Materials,  12  (28): (2401180).  [PMID:] [10.1002/adom.202401180]
66. Shihong Zhu, Daohang Du, Zhimin Zhao, Xianfeng Chu, Daoxiang Su, Shuli Yu, Ting Tao, Yong Jiang, Zhifei Wang.  (2024)  Fabrication of functional interface on magnetic beads via various amino acids and their application in chemiluminescent immunoassay as carrier.  COLLOIDS AND SURFACES B-BIOINTERFACES,      [PMID:39527882] [10.1016/j.colsurfb.2024.114364]
67. Danyi Zhao, Mai Hu, Chenghao Hu, Di Wang, Hailun Chen, Yangwei Ou, Rongli Liu, Xiaoyang Li, Long Wu, Peng Liu, Zhiwei Shen, Qi Chen.  (2024)  Multivalent bifunctional nanobody to enhance the sensitivity of direct competitive chemiluminescence immunoassay for the detection of microcystin LR in lake water.  TALANTA,      [PMID:39467444] [10.1016/j.talanta.2024.127080]
68. Yu-E Gao, Qing Huang, Yue Huang, Li-Xia Yan, Wen-Long Wang, WenFeng Zhao, Yong-Wei Feng, Xiao-Dong Huang, Yi Zhang.  (2024)  Nanoparticle-mediated light-driven LAMP combined with test strips for sensitive and rapid visual detection of antibiotic resistance genes.  JOURNAL OF HAZARDOUS MATERIALS,      [PMID:39752829] [10.1016/j.jhazmat.2024.136981]
69. Wenli Zhu, Miao Hu, Guanghua Su, Weifang Jiang, Hancong Du, Kaxi Chen, Jinfang Nie, Lang Zhang, Xuehui Tang, Yun Zhang.  (2025)  Nanoprobe-free nanosensor with Tyndall-effect readout for colorimetric detection of alkaline phosphatase.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2025.113295]
70. Liping Wu, Min Qing, Zhaode Mu, Jing Zhou, Jianli Zuo, Lijuan Bai.  (2024)  New electrocatalyst of Ni6MnO8@AB/PtNPs with efficient synergistic enhancement in electrochemical aptasensor for sensitive detection of neuron specific enolase.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2024.110639]
71. Huanxin Xiao, Weiguang Chen, Mingxia Lin, Shilin Jiang, Xiping Cui, Suqing Zhao.  (2024)  Rapid immunoassay for dual-mode detection of HPV16 and HPV18 DNA based on Au@PdPt nanoparticles.  Analytical Methods,      [PMID:38463013] [10.1039/D3AY02307A]
72. Jianjian Ji, Yingcai Xiong, Keyu Tao, Tao Li, Weiying Ou, Yinghui Zhou, Wenyang Zhang, Ruogu Qi, Shouchuan Wang.  (2024)  Resveratrol inhibits respiratory syncytial virus replication by targeting heparan sulfate proteoglycan.  Food & Function,      [PMID:38270052] [10.1039/D3FO05131E]
73. Ziru Feng, Mengmeng Yan, Tengfei Li, Wenjun Zhang, Chao Zhu.  (2025)  Screening specific aptamer pairs towards bovine lactoferrin for its sandwich application.  Food Bioscience,      [PMID:] [10.1016/j.fbio.2025.105911]
74. Jialuo Ai, Yixuan Huang, Zhaoyi Yin, Yingshan Deng, Ling Yan, Jingwen Liao, Guoyan Liang, Chong Chen, Yunbing Chang, Cairong Xiao, Jiale Zhou, Zurong Zhu, Chengli Liu, Zhuo Jiang, Chengyun Ning, Zhengao Wang.  (2024)  SEA Anemone-inspired Conducting Polymer Sensing Platform for Integrated Detection of Tumor Protein Marker and Circulating Tumor Cell.  Advanced Healthcare Materials,      [PMID:38767216] [10.1002/adhm.202401305]
75. Yi Zhang, Jing Cao, Jie Zhou, Wen-Long Wang, Zhenghua Xu, Yong-Wei Feng, Xiao-Dong Huang, Feng-De Yu, Xin Yang.  (2024)  Strand displacement amplification combining photothermal-colorimetric dual mode test strip for ultra-sensitive detection of patulin.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2024.112109]
76. Qiang Zhang, Junlei Zhao, Anqi Han, Xiaonan Zhang, Mingya Yang, Hui Li, Benli Yu, Guosheng Zhang, Sheng Zhou.  (2024)  Ultrasensitive cancer cell sensing based on tapered optical fiber operating near the dispersion turning point.  SENSORS AND ACTUATORS B-CHEMICAL,      [PMID:] [10.1016/j.snb.2024.135473]
77. Songbai Tian, Tingting Xiang, Xinghu Ji, Fuxiang Zhou, Zhike He.  (2025)  Membrane-based microfluidic chip constructed and applied in magnetic microparticle anchoring-and-release digital immunoassay.  TALANTA,      [PMID:40743937] [10.1016/j.talanta.2025.128644]
78. Xiaojuan You, Mingyi Shao, Huadong Wang, Rui Zhu, Xinwei Liu, Lei Dong, Yuesheng Gong, Yongwei Li.  (2025)  An electrochemical aptasensor for detection of Helicobacter pylori based on AuNPs and AgNPs-GO nanoparticles.  Frontiers in Bioengineering and Biotechnology,      [PMID:40704101] [10.3389/fbioe.2025.1619336]
79. Xiru Zhang, Manyan Qiu, Yiyi Zhang, Qianyu Zhao, Bo Qu, Wei Zhang, Xianlong Zhang, Yujun Jiang.  (2025)  Pyrococcus furiosus Argonaute biosensing platform based on hemin@ZIF-90 nanozyme-modulated signal amplification for sensitive detection of Salmonella typhimurium.  FOOD CHEMISTRY,      [PMID:40845695] [10.1016/j.foodchem.2025.145952]
80. Lixia Li, Yurui Huang, Jiabin Zhao, Feiyou Liu, Ning Feng, Yufang Liu.  (2025)  Deep learning-enhanced ultra-sensitive fiber optic SPR sensor for mercury ion detection.  INFRARED PHYSICS & TECHNOLOGY,      [PMID:] [10.1016/j.infrared.2025.106128]
81. Haiyan Zhao, Yunzhi Zhao, Shanshan Li, Meiya Zhang, Na Li, Min Cui, Cong Zhang.  (2025)  Dual-signal ratiometric electrochemical aptasensor based on COFs-derived Fe/N-doped porous carbon and methylene blue-enriched COFs for sensitive and accurate detection of kanamycin.  FOOD CHEMISTRY,      [PMID:41014848] [10.1016/j.foodchem.2025.146517]
82. Zhao Fengxia, Jia Shiyu, Yan Hangli, Bai Qinqin, Hu Hongmei, Liang Hao, Niu Xiangheng.  (2025)  Label-free HCR-facilitated nanozyme catalysis and fluorescence simultaneous amplification for ultrasensitive dual-signal sensing of foodborne Salmonella typhimurium.  MICROCHIMICA ACTA,  192  (10): (1-10).  [PMID:40952515] [10.1007/s00604-025-07510-5]
83. Zhenfeng Yu, Jialing Zhou, Zi-Han Chen, Zhihua Wang, Aliyah Almomen, Ahmed Mohamed El-Toni, Aibin Liang, Yong Fan, Fan Zhang.  (2025)  A Multifunctional NIR-II Rare-Earth Nanoagent for In Vivo Monitoring Cancer Revascularization and Prognosis.  ADVANCED FUNCTIONAL MATERIALS,      [PMID:] [10.1002/adfm.202527382]
84. Shun Hu, Liding Zhang, Ying Su, Xiaohan Liang, Jie Yang, Qingming Luo, Haiming Luo.  (2024)  Sensitive detection of multiple blood biomarkers via immunomagnetic exosomal PCR for the diagnosis of Alzheimer’s disease.  Science Advances,  10  (13):   [PMID:38536917] [10.1126/sciadv.abm3088]
85. Shengen Gu, Jiao Lei, Shuaihang Guo, Jun Sun, Yu Duan, Aiqing Li, Mengying Zhan, Lisha Pan, Feng Zhou, Xiaoli Liu, Hong Chen.  (2025)  Renewable and Switchable Biofunctional Modification of Poly(dimethylsiloxane) Surfaces via Host–Guest Interactions for Enhanced Capture of Circulating Tumor Cells in Microfluidics.  ACS Applied Materials & Interfaces,      [PMID:40257044] [10.1021/acsami.5c00707]
86. Lixia Li, Jiabin Zhao, Mingdeng Jin, Siyuan Wu, Feiyou Liu, Yurui Huang, Ning Feng, Yufang Liu.  (2025)  Indium tin oxide/gold/graphene oxide composite membrane structure and gold nanoparticles synergistically enhanced fiber optic sensor for mercury ion detection.  MEASUREMENT,      [PMID:] [10.1016/j.measurement.2025.117735]
87. Lianpeng Lv, Xiaojing Kang, Lubin Hua, Zejian Du, Ruixue Sun, Yefeng Deng, Hailiang Yang, Zheng Xu, Yang Zhou, Bing Wang.  (2025)  Sandwich-type electrochemical immunosensor based on MXene/CNTs substrate and MOFs (MIL-101) probe for leather artifact identification.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2025.113810]
88. Haowei Dong, Jingcheng Huang, Zhen Guo, Haifang Wang, Lingjun Geng, Ziping Cai, Ibrahim A. Darwish, Yemin Guo, Xia Sun, Yanfang Wu.  (2025)  Prussian blue nanoparticles-based signal amplification in aptamer-based lateral flow assay for procymidone detection.  JOURNAL OF FOOD COMPOSITION AND ANALYSIS,      [PMID:] [10.1016/j.jfca.2025.107756]
89. Weiming Lin, Tao Ding, Die He, Nan Zhang, Haodong Li, Wenjian Luo, Zhongxia Wei, Min Ke, Sisi Jia, Chunhai Fan, Le Liang.  (2025)  DNA Logic-Integrated Quantum Nanosensor for MicroRNA Diagnostics.  JACS Au,      [PMID:40443878] [10.1021/jacsau.5c00058]
90. Lixia Li, Yurui Huang, Siyuan Wu, Mingdeng Jin, Jiabin Zhao, Feiyou Liu, Yiyang Shen, Ning Feng, Yufang Liu.  (2025)  Metal-organic frameworks/graphene oxide synergistic enhanced optical fiber SPR sensor for ultra-trace lead ions detection.  OPTICS AND LASERS IN ENGINEERING,      [PMID:] [10.1016/j.optlaseng.2025.109115]
91. Yixuan Yang, Xia Liu, Lanlan Jia, Jiabo Wang, Qianhui Wu, Minglei Zhang, Yusi Bu, Xiaoyu Xie.  (2025)  Leukocyte Membrane-Coated Filtrable Micromotors With Selective Distribution of Enzymes for Capturing and Sensing Circulating Tumor Cells.  Small,      [PMID:41043038] [10.1002/smll.202507095]
92. Jiang Wenxin, Du Huanmin, Huang Xingjie, Lee Luke P., Chen Chia-Hung.  (2025)  Sensitive, high-throughput, metabolic analysis by molecular sensors on the membrane surface of mother yeast cells.  Nature Communications,  16  (1): (1-14).  [PMID:41057294] [10.1038/s41467-025-63964-4]
93. Kun Fu, Jia Zheng, Yichao Zhang, Chang Liu, Wenxiang Zhang, Siyu Chen.  (2025)  Construction of a multiplex biosensor for the on-site rapid detection of phthalates in biological fluids based on single-stranded DNA aptamers.  JOURNAL OF HAZARDOUS MATERIALS,      [PMID:41109023] [10.1016/j.jhazmat.2025.140164]
94. Meiyun Shang, Juan Hu, Mengjia Shi, Yunpeng Fan, Yuan Zou, Yong Wang, Jinhong Guo, Cuiping Mao.  (2025)  Zr-MOF encapsulated-magnetic beads-based fast and efficient conjugation strategy for sensitive immunoassays and early diagnosis of rheumatoid arthritis.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2025.115926]
95. Zheng Liu-Ting, Yan Zeng-Shuai, Li Xin-Yue, Chang Jia-Jia, Tan Xiao-Qi, Wang Yu-Xing, Ding Hong-Ming, Liu Qin, Ma Yu-Qiang, Huo Da.  (2025)  Nanomaterial signatures program biomolecular condensates via triphasic separation for chemoplasticity remodeling.  Nature Communications,  16  (1): (1-24).  [PMID:41162367] [10.1038/s41467-025-64623-4]
96. Xin Yu, Jingzhang Wang, Guanghao Huang, Lianqun Zhou, Zhenjie Zhang, Shuzhi Sam Ge, Qing Wang, Hui Kong.  (2025)  Highly sensitive detection of C-reactive protein in sweat via dendritic gold structure with double-antibody sandwich assay.  SENSORS AND ACTUATORS B-CHEMICAL,      [PMID:] [10.1016/j.snb.2025.139180]
97. Weixuan Liu, Wen Yan, Lingmei Niu.  (2025)  A dual-target fluorescent assay for rapid detection of foodborne pathogens based on aptamer–magnetic bead technology.  Analytical Methods,      [PMID:41328792] [10.1039/D5AY01696G]
98. Liu-Feng Yu, Jie Zhou, Jing Cao, Bing-Huang Zhu, Yue Huang, Li-Xia Yan, Xiao-Dong Huang, Yi Zhang, Wei Gao.  (2025)  Dual-functional Cu2-xSe nanoparticles enabled photothermal SDA-LFA for sensitive miRNA-146a on-site detection in dairy safety.  TALANTA,      [PMID:41406696] [10.1016/j.talanta.2025.129265]
99. Baiqi Cui, Xiaoyin Liu, Jinbiao Ma, Jingyu Wu, Yunxiao Wang, Haiying Ding, Di Wang, Qingjun Liu, Fenni Zhang.  (2025)  Phase-Sensitive Surface Plasmon Resonance Imaging with Polarization Modulation and Stokes Vector Measurement.  ACS Sensors,      [PMID:41035361] [10.1021/acssensors.5c02048]
100. Li Yixian, Yang Xiaohui, Cheng Shanshan, Mu Rongrong, Li Huiqiang, Yu Yang.  (2025)  A bidirectional immuno-microfluidic chip for detecting autoantibodies based on an indirect assay.  MICROCHIMICA ACTA,  193  (1): (28).  [PMID:41405727] [10.1007/s00604-025-07743-4]
101. Xiaoshuo Li, Xinyue Ma, Zhuolin Fu, Zongwen Jin, Chunyan Sun, Xue Qiu, Jiajia Guo.  (2026)  Ultrasensitive duplex lateral flow immunoassay for enhanced detection of viral antigens using hybridization chain reaction amplification.  MICROCHEMICAL JOURNAL,      [PMID:] [10.1016/j.microc.2026.117144]
102. Chuwen Song, Rong Huang, Peiyong Song, Ke Shi, Jianming Li, Yiyang Lin.  (2026)  Engineering Nucleobase-Functionalized Bottlebrush Polymers as Multivalent Ligands for the Surface Protection of Colloidal Nanomaterials.  ACS Applied Nano Materials,      [PMID:] [10.1021/acsanm.5c05026]
103. Qizhi Diao, Sha Tang, Xin Liu, Jiajia Li, Xiangmin Zhou, Yuanyu Chen, Qiongyuan Zhang, Fangyu Yang.  (2026)  LAMP-LFD: establishment and evaluation of a new diagnostic platform for SARS-CoV-2 rapid detection.  Frontiers in Public Health,      [PMID:41952823] [10.3389/fpubh.2026.1798338]
104. Tingling Lin, Shiqing Li, Yi Huang, Shuncong Zhong, Fuwei Sun, Yujie Zhong, Qiuming Zeng, Rongkun Yuan, Yonglin Huang.  (2026)  Intense terahertz field confined metallic nanoarchitectures for targeted actively capturing and specific biosensing via multi-step surface functionalization.  SENSORS AND ACTUATORS B-CHEMICAL,      [PMID:] [10.1016/j.snb.2026.139794]
105. Wanqi Zhang, Lu Han, Yanhao Yin, Yaoting Mou, Yuhang Tian, Zhicong Sun, Yanfang Wu, Dongfei Chen, Yemin Guo, Xia Sun, Falan Li.  (2026)  Dual signal amplification-based lateral flow strip for rapid and sensitive detection of streptomycin in milk.  Food Bioscience,      [PMID:] [10.1016/j.fbio.2026.108646]
106. Xinwei Zhang, Chonglu Li, Mingzhe Yan, Yuting Wang, You Dou, Tuotuo Zhang, Shuo Zheng, Hanying Wang, Junrong Li, Yao Sun.  (2026)  Molecularly Engineered SERS Platform with Microturbulence-Enhanced Electrohydrodynamics for Multiplexed Profiling of Lung Cancer ctDNA.  Journal of the American Chemical Society,      [PMID:41885059] [10.1021/jacs.6c01526]
107. Qing Kang, Yidi Liu, Xiubing Cui, Jianming Chu, Tong Lin, Jingbo Jiao, Xinjun Du, Shuo Wang.  (2026)  A Multivalent Aptamer-Driven “4 + 1” Nanozyme Platform for Ultrasensitive Detection and Synergistic Inactivation of Salmonella typhimurium.  ANALYTICAL CHEMISTRY,      [PMID:41808353] [10.1021/acs.analchem.5c08087]
108. Zhengqi Wang, Yangliu Zhou, Bo Qian, Mingya Yang, Xiaonan Zhang, Benli Yu, Sheng Zhou.  (2026)  Ultra-Sensitive Cancer Cell Detection Based on the Vernier Effect of Taper-In-Taper Structured Optical Fibers.  MICROWAVE AND OPTICAL TECHNOLOGY LETTERS,  68  (7): (e70699).  [PMID:] [10.1002/mop.70699]
109. Wang Zilun, Zhao Zeyu, Jiang Xiangwei, Fu Muqing, Zheng Zhiwen, Duan Xuexin, Xue Qiannan, You Rui.  (2026)  Biomimetic Tri-Phase Hierarchical Interface Enables Ultra-Efficient Enrichment and Sensing of Respiratory Viruses in Exhaled Breath.  ACS Sensors,      [PMID:42634588] [10.1021/acssensors.6c00255]
110. Feng Lin, Wanglong Li, Xinhuang Hou, Wei Lin, Xiaoling Lai, Xiaoqi Zheng, Luyao Li, Wenqian Sun, Jun Lin, Pinjie Lin, Feilin Lian, Fanggang Cai, Kun Wang, Yiquan Dai.  (2026)  Proximity-confined DNA walking-nanozyme cascades for multiplexed urinary extracellular vesicle phenotyping and machine learning-assisted disease stratification.  BIOSENSORS & BIOELECTRONICS,      [PMID:] [10.1016/j.bios.2026.119109]
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Preguntas frecuentes

What is the purity of this product?
This product is supplied at ≥98% purity (chemical assay). Lot-specific values are stated on the Certificate of Analysis.
What does BioReagent mean?
BioReagent indicates that the product has been processed and tested for biological and biochemical applications. Specifications may include endotoxin limits, microbial controls, sterility, low DNase/RNase/protease activity, and verified biological activity where relevant.
How should this product be stored?
Store at ?20 °C under argon. It is supplied under an argon blanket; reseal under inert gas after each use.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What are the CAS number, molecular formula and molecular weight?
The CAS Number is 9013-20-1.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.