The store will not work correctly when cookies are disabled.
Javascript est désactivé dans votre navigateur. Pour une meilleure expérience sur notre site, assurez-vous d’activer JavaScript dans votre navigateur.
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock Oxyntomodulin TFA, CAS No.62340-29-8(free base) 🧪
Why this grade ≥97% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
🌡
Storage & shipping Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
📋
Quality documents SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
📚
Literature proof Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Vue d’ensemble Oxyntomodulin TFA, a 37-amino acid peptide hormone, is a Glukagon-like peptide 1 (GLP-1) receptor agonist.
Specifications Product Name
Oxyntomodulin TFA, CAS No.62340-29-8(free base)
Synonymes
Glucagon (1-37)(TFA) | Enteroglucagon(TFA)
Spécifications et pureté
≥97%
Séquence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Stockage et expédition Conditions de stockage de stockage
Store at -20°C,Desiccated
Expédié en
Ice chest + Ice pads
Documentation 📋 Safety Data Sheet (SDS) Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS → ✅ Certificate of Analysis (COA) Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA → 📊 Datasheet Quick-reference summary of product specifications and applications.
View datasheet → 🔬 Specification Sheet Full quality attributes and acceptance criteria for this grade.
View spec sheet →
Advanced Data Certificats (CoA, COO, BSE/TSE et tableau d'analyse) Calculateurs de solution Molarity Calculator Determine the necessary mass, volume, or concentration for preparing a solution.
Dilution Calculator Determine the dilution needed to prepare a stock solution.
Reconstitution Calculator Avis
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Paramètres Accepter tout Refuser
Shall we send you a message when we have discounts available?
Remind me later Autoriser
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.