Recombinant Human CD157 Protein

Cat. No.: rp143341
DISPONIBLE À COMMANDE
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
Q10588
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to convert the substrate nicotinamide guanine dinucleotide (NGD+) to cyclic GDP-ribose. The specific activity is >20 pmol/min/µg, as measured under the described conditions.
★
Size
Allemagne (EU)
USA*
Price
Qty
10μg
rp143341-10μg
—
En stock ≥10
121,40€
50μg
rp143341-50μg
—
3 En stock
347,01€
100μg
rp143341-100μg
—
1 En stock
555,27€
1mg
rp143341-1mg
Sur commande · 8–12 semaines

3 024,85€

4 251,83€
Enregistrer 1 226,98 € (28.86%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Vue d’ensemble

Function
Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth.

Specifications

Product Name
Recombinant Human CD157 Protein
Synonymes
ADP-ribosyl cyclase 2 | Bone marrow stromal antigen 1 | BST-1 | cADPr hydrolase 2 | Cyclic ADP-ribose hydrolase 2 | EC 3.2.2.6 | ADP-ribosyl cyclase 2 | Bone marrow stromal antigen 1 | bone marrow stromal cell antigen 1 | BP-3 | BST1 | BST-1 | cADPr hydro
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag
Spécifications et pureté
Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE)
Bioactivité
Measured by its ability to convert the substrate nicotinamide guanine dinucleotide (NGD+) to cyclic GDP-ribose. The specific activity is >20 pmol/min/µg, as measured under the described conditions.
Concentration d'endotoxine
<0.1 EU/μg
Système d'expression
HEK293
Espèces
Human
Acides aminés
29-292 aa
Séquence
GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKHHHHHH
Journée des protéines
C-His
Accession #
Poids moléculaire prévu
31 kDa
SDS-PAGE
34 - 45 kDa, under reducing conditions; 34 - 45 kDa, under non-reducing conditions.
Type de molécule
Protein
Stockage et expédition
Forme
Liquid
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Conditions de stockage de stockage
Store at -20°C,Avoid repeated freezing and thawing
Expédié en
Ice chest + Ice pads
Stabilité et stockage
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human CD157 Protein (rp143341) - SDS-PAGE
3 μg/lane of Recombinant Human CD157 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 34 - 45 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificats (CoA, COO, BSE/TSE et tableau d'analyse)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateArticle
ZJ24F1215224Certificate of AnalysisJul 16, 2026 rp143341
ZJ24F1215225Certificate of AnalysisJul 16, 2026 rp143341
ZJ24F1215226Certificate of AnalysisJul 16, 2026 rp143341
Calculateurs de solution
Avis

Avis des clients

Foire aux questions

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.