Recombinant Human CD72 Protein

Cat. No.: rp181592

GRADE & PURITY Animal Free, Carrier Free, His Tag, PBS Only, ≥90%(SDS-PAGE)

Accession #

P21854

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Vue d’ensemble

CD72, also known as Lyb‑2, is a 40‑45 kDa type II transmembrane glycoprotein that plays a role in immune system regulation. Mature human CD72 consists of a 95 amino acid (aa) cytoplasmic domain with two immunoreceptor tyrosine‑based inhibitory motifs (ITIMs), a 21 aa transmembrane segment, and a 243 aa extracellular domain with a coiled‑coil domain and a C‑type lectin domain. Within the ECD, human CD72 shares 48% and 44% aa sequence identity with mouse and rat CD72, respectively. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 binds to CD5 with mouse/human cross‑reactivity and to Semaphorin 4D/CD100. It associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP‑1. CD72 ligation with antibodies or with Semaphorin 4D induces tyrosine dephosphorylation of the CD72 cytoplasmic domain and its dissociation from SHP‑1, leading to B cell proliferation. Both CD72 and Semaphorin 4D are required for the maintenance of B cell anergy and the regulation of peripheral B cell tolerance as shown by the development of autoimmunity in mice that lack either molecule. In addition to its negative regulation of BCR signaling, CD72 can induce positive signaling in B cells independent of the BCR. CD72 binding to Semaphorin 4D induces cytokine production by monocytes and dendritic cells, inhibits SCF R/c‑kit induced mast cell proliferation and activation, and inhibits the cytolytic activity of NK cells. Semaphorin 4D is expressed on activated NK cells and contributes to the adhesive interaction between NK and CD72+ target cells leading to a more efficient killing and enhanced IFN-gamma secretion.

Specifications

Product Name

Recombinant Human CD72 Protein

Synonymes

CD72 antigen | B-cell differentiation antigen CD72 | B cell differentiation antigen CD72 | CD72 molecule | CD72_HUMAN | CD72 | CD72b | Ly-19.2 | Ly-32.2 | Lyb-2 | LYB2 | lyb-2 | Lyb2

Grade

Animal Free, Carrier Free, His Tag, PBS Only

Spécifications et pureté

Animal Free,Carrier Free,His Tag,PBS Only,≥90%(SDS-PAGE)

Bioactivité

Testing in progress

Concentration d'endotoxine

<1.0 EU/μg

Système d'expression

HEK293

Acides aminés

117-359 aa

Séquence

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDHHHHHH

Journée des protéines

C-His

Accession #

P21854

Poids moléculaire prévu

28.9 kDa

SDS-PAGE

30.6-37.0 kDa, under reducing conditions

Type de molécule

Protein

Product Line

Produits biologiques

Stockage et expédition

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Conditions de stockage de stockage

Store at -20°C,Avoid repeated freezing and thawing

Expédié en

Ice chest + Ice pads

Stabilité et stockage

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human CD72 Protein (rp181592)

Recombinant Human CD72 Protein (rp181592) - SDS-PAGE
3 μg/lane of Recombinant Human CD72 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 30.6-37.0 kDa.

Foire aux questions

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What is the purity of this product, and how is it determined?

This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Animal Free mean?

Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.