Recombinant Human Complement Component C3a Protein

Cat. No.: rp183573

QUALITÉ & PURETÉ Carrier Free, PBS Only, ≥95%(SDS-PAGE)

Accession #

P01024

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Spécifications

Product Name

Recombinant Human Complement Component C3a Protein

Synonymes

AHUS5 | ARMD9 | ASP | C3a | C3b | Complement C3 | CPAMD1 | Anaphylatoxin | Complement Component C3a

Grade

Carrier Free, PBS Only

Spécifications et pureté

Carrier Free,PBS Only,≥95%(SDS-PAGE)

Mécanismes biochimiques et physiologiques

C3a is an anaphylotoxin polypeptide comprising amino acids (aa) 672-748 of the Complement C3 precursor protein. Anaphylatoxins are proteolytically generated from the C3, C4 and C5 alpha chains by convertases formed by other complement fragments. They shar

Bioactivité

Testing in progress

Concentration d'endotoxine

<1.0 EU/μg

Acides aminés

672-748 aa

Séquence

SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

Accession #

P01024

Poids moléculaire prévu

9.1 kDa

SDS-PAGE

10.9 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions.

Type de molécule

Protein

Product Line

Produits biologiques

Stockage et expédition

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Conditions de stockage de stockage

Store at -20°C,Avoid repeated freezing and thawing

Expédié en

Ice chest + Ice pads

Stabilité et stockage

Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Human Complement Component C3a Protein (rp183573)

Recombinant Human Complement Component C3a Protein (rp183573) - SDS-PAGE
3 μg/lane of Recombinant Human Complement Component C3a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.9 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.

Cibles associées (humaines)

C3 Tclin Complement C3 (0 Activities)

Discover Target: C3

Activity Type	Activity Value -log(M)	Mechanism of Action	Activity Reference	Publications (PubMed IDs)

Foire aux questions

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does PBS Only mean?

PBS Only is a defined analytical purity tier suitable for workflows requiring a specific validated property. It specifies a minimum assay percentage, controlled limits on common impurities (water, heavy metals, residue on ignition), and lot-to-lot consistency. PBS Only is one of several purity tiers — choose based on the sensitivity and regulatory requirements of your method.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.