Recombinant Human EIF3S1/EIF3J Protein

Cat. No.: rp192076

QUALITÉ & PURETÉ Carrier Free, Bioactive, ActiBioPure™, His Tag, ≥90%(SDS-PAGE), See COA

Accession #

O75822

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Immobilized Recombinant Human EIF3S1/EIF3J Protein (rp192076) at 1.0 μg/mL can bind EIF3S1/EIF3J Antibody (Ab101341) with the EC50 of 72.7 ng/mL.

Spécifications

Product Name

Recombinant Human EIF3S1/EIF3J Protein

Synonymes

eIF 3 alpha | eIF-3-alpha | eIF3 alpha | eIF3 p35 | eIF3j | EIF3J_HUMAN | EIF3S 1 | EIF3S1 | Eukaryotic translation initiation factor 3 subunit 1 | Eukaryotic translation initiation factor 3 subunit J | Eukaryotic translation initiation factor 3, subunit

Grade

ActiBioPure™, Bioactive, Carrier Free, His Tag

Spécifications et pureté

Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥90%(SDS-PAGE),See COA

Mécanismes biochimiques et physiologiques

Eukaryotic translation initiation factor 3 subunit J (EIF3J) is a member of the EIF-3 subunit J family. EIF3 has a crucial role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to produce the 40S initiation complex. EIF3J binds

Bioactivité

Immobilized Recombinant Human EIF3S1/EIF3J Protein (rp192076) at 1.0 μg/mL can bind EIF3S1/EIF3J Antibody (Ab101341) with the EC50 of 72.7 ng/mL.

Concentration d'endotoxine

<1.0 EU/μg

Acides aminés

70-258 aa

Séquence

MHHHHHHKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM

Accession #

O75822

Poids moléculaire prévu

22.7 kDa

SDS-PAGE

26.6 kDa, under reducing conditions; 26.6 kDa, under non-reducing conditions.

Type de molécule

Protein

Product Line

Produits biologiques

Stockage et expédition

Concentration

See COA

Conditions de stockage de stockage

Store at -20°C,Avoid repeated freezing and thawing

Expédié en

Ice chest + Ice pads

Stabilité et stockage

Store at -20℃ for 6 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

ELISA: Recombinant Human EIF3S1/EIF3J Protein (rp192076)

Recombinant Human EIF3S1/EIF3J Protein (rp192076) - ELISA
Immobilized Recombinant Human EIF3S1/EIF3J Protein (rp192076) at 1.0 μg/mL can bind EIF3S1/EIF3J Antibody (Ab101341) with the EC50 of 72.7 ng/mL.

SDS-PAGE: Recombinant Human EIF3S1/EIF3J Protein (rp192076)

Recombinant Human EIF3S1/EIF3J Protein (rp192076) - SDS-PAGE
3 μg/lane of Recombinant Human EIF3S1/EIF3J Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.6 kDa.

Application Protocols

Item-specific validated protocols are not provided. The following are general starting points to adapt and optimize; they are not specifications.

• Reconstitution (overview)

  • Briefly centrifuge the vial to collect contents. Add a small volume of cold, sterile buffer (e.g., PBS or HEPES, pH ~7.2–7.5) to reach a convenient stock concentration. Mix gently without foaming. Allow complete dissolution on ice.

• His-tag pull-down (general)

  • Equilibrate Ni-NTA resin in binding buffer containing low imidazole. Incubate His-tagged EIF3J with resin at 4°C with gentle mixing. Wash to baseline A280 with increased imidazole or salt as needed. Elute with 100–300 mM imidazole. Analyze inputs/flows by SDS-PAGE.

• ELISA coating (general)

  • Dilute protein in carbonate or PBS coating buffer. Coat high-binding plates (e.g., 1–5 µg/mL) overnight at 4°C. Block, then probe with primary antibody against EIF3J followed by HRP-conjugate. Develop and read per standard methods.

• SPR/BLI (general)

  • Immobilize via His tag (NTA sensor) or amine coupling. Run kinetics in matched buffers with surfactant and appropriate salt to minimize mass transport and nonspecific binding.

For all applications: Optimize concentration, temperature, incubation time, and buffer composition empirically. Consult the CoA for any lot-specific recommendations.

Biological Roles

The EIF3S1/EIF3J protein is a subunit of the eukaryotic translation initiation factor 3 (eIF3) complex.

General literature context

• Functional role: EIF3J contributes to assembly and stabilization of the 43S pre-initiation complex, aids in 40S ribosomal subunit association, and can modulate mRNA recruitment and scanning efficiency in concert with other eIF3 subunits.
• Interactions: Interfaces with components of the eIF3 core and contacts the 18S rRNA/40S platform; reported to influence dissociation of post-termination complexes and ribosome recycling in some systems.
• Cellular localization: Predominantly cytosolic, enriched in ribosome-associated fractions.
• Regulation: Expression and association with eIF3 can vary with cellular state; post-translational modifications have been reported for some translation factors (details are protein- and context-specific).

Research implications

• Recombinant EIF3J enables mechanistic dissection of translation initiation by stepwise reconstitution with purified ribosomal subunits and initiation factors.
• Useful as a defined component to test the effect of mutations, truncations, or tags on binding and function (when such engineered variants are prepared).

Item-specific bioactivity assay details and results: Not specified for this item; refer to CoA/Spec Sheet.

Buffer Applications

This product is a recombinant protein and is not itself used as a buffering agent.

Practical buffer considerations for using this protein (general)

• Working buffer: Near-neutral pH (e.g., phosphate or HEPES) commonly preserves protein structure; exact composition for this item is not specified.
• Ionic strength: Moderate salt can reduce nonspecific interactions in binding assays.
• Additives: Glycerol or sugars may improve freeze–thaw resilience; verify compatibility with downstream assays.
• Sterility: For cell-free biochemical assays, 0.22 µm sterile filtration of buffers is recommended to minimize bioburden without adding preservatives.

Item-specific formulation/buffer composition: Not specified for this item; consult CoA/Spec Sheet for exact excipients if provided.

Green Alternatives

Green chemistry considerations for protein reagents focus on buffer systems, consumables, and cold-chain logistics rather than solvent substitution.

• Buffer choices

  • Prefer non-hazardous, phosphate- or HEPES-based buffers at neutral pH. Avoid azide where possible if downstream cell-based assays are planned; use sterile filtration for preservation instead.
  • Minimize use of guanidine/urea denaturants and high concentrations of imidazole except where necessary; recover and reuse IMAC resins per manufacturer guidance.

• Process and consumables

  • Use recyclable plastics where feasible and low-binding tubes to reduce the need for carrier proteins.
  • Batch aliquoting reduces waste from repeated freeze–thaw and extends product life, minimizing repeat shipments.

• Cold chain and energy use

  • Coordinate deliveries to limit time on dry/ice packs and promptly transfer to -20°C storage as specified.

Comparison (general)

• Sodium azide vs. sterile filtration: Azide simplifies microbial control but adds toxicity and hazardous waste; sterile filtration and aseptic technique are greener for many in vitro workflows.
• Single-use vs. reusable chromatography hardware: Reusable Ni-NTA columns reduce plastic waste; ensure proper regeneration to maintain performance.

Item-specific green attributes or stabilizers: Not specified for this item; consult CoA for formulation details.

Pharmaceutical Uses

This product is intended strictly for research use only and is not approved for diagnostic or therapeutic applications.

Possible roles in pharmaceutical research and manufacturing (general)

• Assay development: Reference antigen or control in ligand-binding assays that detect EIF3J.
• Target validation: Component in in vitro translation systems or ribosome interactome studies to interrogate initiation pathways.
• Bioprocess analytics: Calibration of analytical methods (e.g., SDS-PAGE, LC–MS peptide mapping) where a defined recombinant protein standard is useful.

Regulatory/compendial status

• No pharmacopeial monograph is applicable to EIF3J. Lot-specific specifications such as purity, identity, and residuals (if any) should be taken from the CoA for internal qualification.

Caveat

• Do not use in humans. Handle according to institutional quality systems for non-GMP research reagents.

Physical Properties

• Appearance: Not specified for this item; refer to CoA/Spec Sheet.
• Molecular weight: Not specified for this item; refer to CoA/Spec Sheet. Note: Human EIF3J core sequence is typically ~27–29 kDa; addition of tags/linkers can increase apparent MW (literature).
• Isoelectric point (pI): Not specified for this item. General literature suggests EIF3J is basic; exact pI depends on sequence and tag.
• Solubility: Not specified for this item. Recombinant proteins are typically formulated in aqueous buffers; solubility depends on buffer composition, ionic strength, pH, and additives (general guidance).
• Extinction coefficient: Not specified for this item; sequence-dependent. Consult CoA for lot-specific A280 calculations.
• Stability: Not specified for this item. Proteins are generally sensitive to repeated freeze–thaw; this item indicates “Avoid repeated freezing and thawing.”
• Viscosity/density, BP/MP, logP: Not applicable for protein solutions/lyophilizates in the conventional small-molecule sense.

Practical notes (general/literature)

• Maintain on ice during handling to limit proteolysis/aggregation.
• Aliquot immediately after initial thaw/reconstitution to minimize freeze–thaw cycles.
• Typical stabilizers for proteins include glycerol, sugars, and inert proteins; any such components for this item are not specified and should be verified on the CoA.

Quality and Grades

• Grade/Purity: Carrier Free, Bioactive, ActiBioPure™, His Tag

What these designations mean

• Carrier Free: The formulation lacks protein carriers (e.g., BSA, gelatin). This enables accurate mass-based dosing, reduces potential assay interference, and supports conjugation or immobilization workflows. It also requires careful handling to avoid adsorption losses on plastic; use low-bind tubes and include inert protein or detergents only if compatible with your assay.
• Bioactive: Supplied in a form that retains biological activity in relevant in vitro assays (specific assay not specified for this item). Activity can be context-dependent; verify performance in your system.
• ActiBioPure™: A manufacturer-specific designation indicating high purity and retention of activity. Exact specifications and acceptance criteria are not provided here; consult the CoA/Spec Sheet for assay results and purity metrics (e.g., SDS-PAGE densitometry, endotoxin, host cell protein/DNA, if available).
• His Tag: Engineered polyhistidine tag for immobilized metal affinity chromatography (IMAC) purification and affinity capture. Tag orientation and length are not specified for this item.

Item-specific quality data

• Purity percent, endotoxin level, residual host contaminants, and activity assay details: Not specified for this item; refer to CoA/Spec Sheet.

Practical implications

• For cell-based work, confirm endotoxin and activity suitability for your application conditions.
• For biophysical assays, carrier-free formulation simplifies accurate molar normalization once the extinction coefficient is known from the sequence.

Reaction and Applications

As a recombinant translation factor subunit, this protein is used in biochemical and biophysical assays rather than small-molecule synthesis.

Representative research applications (general/literature)

• Translation initiation studies: Reconstitution of partial eIF3 assemblies and 43S pre-initiation complexes to probe subunit interactions, 40S binding, and mRNA recruitment roles of EIF3J.
• Protein–protein/RNA interaction mapping: Pull-downs or SPR/BLI assays to quantify EIF3J binding to eIF3 core subunits, 18S rRNA elements, or accessory factors.
• Affinity capture: Use the His tag for immobilization on Ni-NTA/Co2+ matrices to isolate interacting partners from lysates or with purified components.
• Structural biology: As a component for cryo-EM or crosslinking mass spectrometry to assign densities/contacts within eIF3–40S assemblies (literature context).
• Assay development: ELISA antigen or positive control in immunoassays targeting EIF3J (if compatible with antibody epitope recognition).

Practical tips

• Maintain protein on ice and use freshly prepared buffers. Include protease inhibitors when working with cell lysates.
• For pull-downs, titrate imidazole to suppress nonspecific binders without eluting the His-tagged bait.
• Verify activity by a small-scale interaction assay before scaling up experiments.

Manufacturer-specified applications for this item: Not provided beyond “Bioactive”; expand/validate empirically in your system.

Reaction Conditions

This protein is used in biochemical assays rather than chemical reactions. Typical conditions below are general literature guidance and must be optimized per assay; they are not item-specific specifications.

• Pull-down and binding assays

  • Buffer: Near-neutral pH (e.g., HEPES or phosphate), moderate salt to reduce nonspecific interactions; include low imidazole during binding to Ni-NTA if immobilizing via His tag.
  • Temperature: 4–10°C for binding/incubation steps to preserve activity and limit proteolysis.
  • Time: 30–120 minutes for equilibration, depending on partners and concentrations.

• IMAC purification/immobilization (His tag)

  • Binding: 5–20 mM imidazole to suppress nonspecific binders (optimize).
  • Elution: 100–300 mM imidazole or pH shift; verify that elution conditions preserve downstream activity.

• Biophysical assays (SPR/BLI/ITC)

  • Use degassed, filtered buffers; match DMSO (if used for analytes) in all channels; maintain low nonspecific binding with surfactant (e.g., 0.005–0.02% Tween-20) if compatible.

• Reconstitution of complexes

  • Stoichiometry: Determine empirically based on affinity and known subunit ratios; gradual addition and short incubations on ice are common practices.

Safety and Handling

• GHS classification: Not specified for this item; refer to SDS.
• Signal word: Not specified for this item; refer to SDS.
• Hazard statements (H-phrases): Not specified for this item; refer to SDS.
• Pictograms: Not specified for this item; refer to SDS.
• Research use: For research use only (not for diagnostic or therapeutic use).

General laboratory safety for recombinant proteins

• PPE: Use lab coat, disposable nitrile gloves, and safety glasses. Handle solutions in a biosafety cabinet if sterility is required.
• Avoid aerosol generation; open lyophilized vials gently and reconstitute slowly along the wall of the tube.
• Biological origin note: Recombinant protein expressed in a heterologous system (host not specified). Treat as a low-risk biological reagent but follow institutional biosafety practices.
• Incompatibilities: Avoid strong oxidants and extreme pH that can denature protein. Avoid metal chelators if the His tag is needed for downstream affinity capture (e.g., EDTA can strip Ni2+ from IMAC resins).
• First aid (general): In case of skin/eye contact, rinse with water. If inhaled, move to fresh air. If ingested, rinse mouth with water. Seek medical advice if symptoms persist. Defer to SDS for definitive measures.
• Waste: Dispose of unused material and consumables according to local regulations for non-hazardous biological laboratory waste.

Solvent Selection

This is a recombinant protein reagent; conventional organic solvent selection is not typically applicable.

Protein-buffer considerations (general guidance)

• Aqueous buffers: Commonly phosphate- or HEPES-based buffers are used to maintain structural integrity near neutral pH; exact buffer for this item is not specified.
• Ionic strength: Moderate salt (e.g., 100–300 mM NaCl) often improves solubility and reduces nonspecific interactions; verify compatibility with your assay.
• Additives: Glycerol, sugars, or mild nonionic detergents can improve stability and reduce aggregation; presence/absence for this item is not specified.
• Metal chelators: If using the His tag for IMAC binding or pull-down assays, avoid EDTA/EGTA during capture. After elution, chelators can be reintroduced if required.
• Organic co-solvents: Avoid unless specifically validated; many proteins lose activity in >10% v/v organic solvent.

Selection notes

• Choose low-binding plasticware or pre-blocked vessels to minimize adsorption for carrier-free proteins.
• If immobilizing on Ni-NTA or Co2+-charged resins, maintain low imidazole during binding (e.g., trace–10 mM) and elute with higher imidazole (100–300 mM) as appropriate; optimize per assay (general practice).

Storage and Reconstitution

• Storage conditions (item-specific)

  • Store at -20°C.
  • Avoid repeated freezing and thawing.
  • Shipped in an ice chest with ice pads; transfer to specified storage upon receipt.

• Stability notes

  • Actual stability window and formulated excipients are not specified for this item; refer to the CoA/Spec Sheet. As a general practice, maintain material on ice during handling.

• Reconstitution and aliquoting (general guidance)

  • Briefly spin down the vial before opening to collect contents.
  • Reconstitute on ice with sterile, buffered aqueous solution appropriate for your application (e.g., PBS or HEPES at near-neutral pH). Exact buffer for this item is not specified.
  • Mix gently by pipetting; avoid vigorous vortexing and foaming. Allow complete dissolution.
  • Prepare single-use aliquots in low-bind tubes to minimize adsorption and avoid repeated freeze–thaw cycles.
  • For extended storage, many proteins are kept at -80°C; inclusion of 10–50% glycerol is common to enable storage at -20°C without freezing—verify compatibility with your assay.

• Thawing

  • Thaw on ice, mix gently, keep cold during use, and promptly refreeze aliquots not in immediate use.

• Documentation

  • For concentration, calculated extinction coefficient, formulated components, and shelf life, consult the lot-specific CoA/Spec Sheet.

Structure and Identity

Recombinant Human EIF3S1/EIF3J Protein is a tagged recombinant form of the human eukaryotic translation initiation factor 3 subunit J (EIF3J/EIF3S1).

• Item-specific identifiers

  • SKU: rp192076
  • Name: Recombinant Human EIF3S1/EIF3J Protein (His tag)
  • Molecular formula: Not applicable for proteins in empirical form; primary sequence determines composition.
  • Molecular weight (item-specific): Not specified for this item; refer to CoA/Spec Sheet.
  • Sequence/accession: Not specified for this item; refer to CoA/Spec Sheet.
  • Tag: His tag (N- or C-terminal placement not specified).

• Structural features (general/literature)

  • EIF3J is a protein subunit of the human eIF3 complex; typically a basic, largely helical protein that associates with 40S ribosomal subunits and other eIF3 components.
  • Typical monomer size: approximately 27–29 kDa for human EIF3J core sequence; apparent MW may differ with tags/linkers (literature; actual for this item may vary).
  • Functional domains: regions mediating interactions with eIF3 core and the 18S rRNA/40S subunit (literature). No canonical catalytic active site.

• 2D/primary structure description (general)

  • Linear polypeptide chain of standard L-amino acids corresponding to human EIF3J, fused to a polyhistidine affinity tag for IMAC purification and downstream capture.

• Chemical identifiers (SMILES/InChI): Not applicable to macromolecular proteins; not provided for this item.

Synthetic Utility

Classical small-molecule synthetic utility does not apply to recombinant proteins. However, this protein can play a role in biochemical “assembly” and capture workflows.

Biochemical utility (general)

• Affinity handle: The His tag enables immobilization on Ni-NTA/Co2+-charged matrices to capture binding partners (protein or RNA) for discovery and validation.
• Reconstitution component: Serves as a defined subunit in assembling partial eIF3 complexes or 43S pre-initiation complexes with 40S subunits and other initiation factors.
• Structural probe: Can be site-specifically labeled (e.g., with NHS-esters or maleimides if appropriate residues are present) for FRET, crosslinking, or footprinting studies—subject to compatibility with the tag and active surfaces.

Limitations

• Sensitive to denaturation and proteolysis; avoid harsh conditions, extremes of pH, organic solvents, and elevated temperatures.
• If the His tag is required for downstream assays, avoid chelators and high phosphate during immobilization steps that can strip or compete with metal ions.

Target Specificity

This listing is a recombinant protein (EIF3S1/EIF3J), not an antibody or inhibitor; conventional target specificity parameters (epitope, clone, species reactivity, isotype) do not apply.

• Protein identity: Human EIF3S1/EIF3J subunit of the eIF3 complex (recombinant, His-tagged).
• Functional interactions (general/literature): Binds components of the eIF3 complex and associates with the 40S ribosomal subunit and rRNA elements in the context of translation initiation.

Item-specific binding/activity data: Not specified for this item; refer to CoA/Spec Sheet.

Foire aux questions

What is the purity of this product, and how is it determined?

This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

What does Bioactive mean?

Bioactive indicates that the product has been processed and tested for biological and biochemical applications. Specifications may include endotoxin limits, microbial controls, sterility, low DNase/RNase/protease activity, and verified biological activity where relevant.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.