RAB21

DescriptionRas-related protein Rab-21

Gene and Protein Information

Gene ID23011
Uniprot Accession IDs Q9UL25 Q14466 Q569H3
Ensembl ID ENSP00000261263
Symbole KIAA0118
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp467069RAB21RAB21, member RAS oncogene family9598VGNC:13352OMA, EggNOG
Mouse216344Rab21RAB21, member RAS oncogene family10090MGI:894308Inparanoid, OMA, EggNOG
Rat299799Rab21RAB21, member RAS oncogene family10116RGD:1303150Inparanoid, OMA, EggNOG
Dog100683312RAB21RAB21, member RAS oncogene family9615VGNC:45261Inparanoid, OMA, EggNOG
Horse100056811RAB21RAB21, member RAS oncogene family9796VGNC:22094Inparanoid, OMA, EggNOG
Cow781001RAB21RAB21, member RAS oncogene family9913VGNC:33628Inparanoid, OMA, EggNOG
Platypus100087487RAB21RAB21, member RAS oncogene family9258OMA, EggNOG
Chicken771383RAB21RAB21, member RAS oncogene family9031CGNC:7744Inparanoid, OMA, EggNOG
Anole lizard100551608rab21RAB21, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus549073rab21RAB21, member RAS oncogene family8364XB-GENE-486436Inparanoid, OMA, EggNOG
Zebrafish767727zgc:154045zgc:1540457955ZDB-GENE-060929-1062Inparanoid, OMA
C. elegans187932rab-21RAB family6239Inparanoid, OMA
Fruitfly3355163Rab21CG17515 gene product from transcript CG17515-RD7227FBgn0039966Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.