CRABP2

DescriptionCellular retinoic acid-binding protein 2

Gene and Protein Information

Gene ID1382
Uniprot Accession IDs P29373 B2R4Z8 D3DVC5 F1T098 Q6ICN6
Ensembl ID ENSP00000482841
Symbole RBP6 CRABP-II
FamilyBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp469838CRABP2cellular retinoic acid binding protein 29598VGNC:509OMA, EggNOG
Macaque718579CRABP2cellular retinoic acid binding protein 29544Inparanoid, OMA, EggNOG
Mouse12904Crabp2cellular retinoic acid binding protein II10090MGI:88491Inparanoid, OMA, EggNOG
Rat29563Crabp2cellular retinoic acid binding protein 210116RGD:62070Inparanoid, OMA, EggNOG
Dog612093CRABP2cellular retinoic acid binding protein 29615VGNC:39588Inparanoid, OMA, EggNOG
Horse100058072CRABP2cellular retinoic acid binding protein 29796VGNC:16847Inparanoid, OMA, EggNOG
Cow493998CRABP2cellular retinoic acid binding protein 29913VGNC:27686Inparanoid, OMA, EggNOG
Pig100155151CRABP2cellular retinoic acid binding protein 29823Inparanoid, OMA, EggNOG
Opossum100018489CRABP2cellular retinoic acid binding protein 213616Inparanoid, OMA, EggNOG
Anole lizard100556219crabp2cellular retinoic acid binding protein 228377Inparanoid, OMA
Xenopus448629crabp2cellular retinoic acid binding protein 28364XB-GENE-959098Inparanoid, OMA
Zebrafish503502crabp2bcellular retinoic acid binding protein 2, b7955ZDB-GENE-050208-52Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.