🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PDK1

Description[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial

Gene and Protein Information

Gene ID5163
Uniprot Accession IDs Q15118 B2R6T1 B7Z937 D3DPD8 E9PD65 Q308M4
Ensembl ID ENSP00000376352
Symbole PDHK1
FamilyBelongs to the PDK/BCKDK protein kinase family.
Sequence
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp459743PDK1pyruvate dehydrogenase kinase 19598VGNC:6370OMA, EggNOG
Macaque697772PDK1pyruvate dehydrogenase kinase 19544OMA, EggNOG
Mouse228026Pdk1pyruvate dehydrogenase kinase, isoenzyme 110090MGI:1926119Inparanoid, OMA, EggNOG
Rat116551Pdk1pyruvate dehydrogenase kinase 110116RGD:69427Inparanoid, OMA, EggNOG
Dog476828PDK1pyruvate dehydrogenase kinase 19615Inparanoid, OMA, EggNOG
Horse100064091PDK1pyruvate dehydrogenase kinase 19796VGNC:21268Inparanoid, OMA, EggNOG
Cow528655PDK1pyruvate dehydrogenase kinase 19913VGNC:32703Inparanoid, OMA, EggNOG
Pig100286871PDK1pyruvate dehydrogenase kinase 19823Inparanoid, OMA, EggNOG
Opossum100617164PDK1pyruvate dehydrogenase kinase 113616OMA, EggNOG
Platypus100084173PDK1pyruvate dehydrogenase kinase 19258Inparanoid, OMA, EggNOG
Chicken425972PDK1pyruvate dehydrogenase kinase 19031CGNC:52628Inparanoid, OMA
Anole lizard100555492pdk1pyruvate dehydrogenase kinase 128377Inparanoid, OMA
Xenopus100497838pdk1pyruvate dehydrogenase kinase 18364XB-GENE-483609Inparanoid, OMA
Zebrafish555840pdk1pyruvate dehydrogenase kinase, isozyme 17955ZDB-GENE-091204-402Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.