Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Platelet-derived growth factor C |
|---|
Gene and Protein Information
| Gene ID | 56034 |
|---|---|
| Uniprot Accession IDs | Q9NRA1 B4DU34 B9EGR8 Q4W5M9 Q9UL22 PDGF-C |
| Ensembl ID | ENSP00000422464 |
| Symbole | SCDGF SCDGF FALLOTEIN |
| Family | Belongs to the PDGF/VEGF growth factor family. |
| Sequence | MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 736477 | PDGFC | platelet derived growth factor C | 9598 | VGNC:657 | OMA, EggNOG |
| Macaque | 700236 | PDGFC | platelet derived growth factor C | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 54635 | Pdgfc | platelet-derived growth factor, C polypeptide | 10090 | MGI:1859631 | Inparanoid, OMA, EggNOG |
| Rat | 79429 | Pdgfc | platelet derived growth factor C | 10116 | RGD:68410 | Inparanoid, OMA, EggNOG |
| Dog | 482666 | PDGFC | platelet derived growth factor C | 9615 | VGNC:44370 | Inparanoid, OMA, EggNOG |
| Horse | 100062015 | PDGFC | platelet derived growth factor C | 9796 | VGNC:21259 | Inparanoid, OMA, EggNOG |
| Cow | 613787 | PDGFC | platelet derived growth factor C | 9913 | VGNC:53915 | Inparanoid, OMA, EggNOG |
| Pig | 100515267 | PDGFC | platelet derived growth factor C | 9823 | OMA, EggNOG | |
| Opossum | 100023701 | PDGFC | platelet derived growth factor C | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100079757 | PDGFC | platelet derived growth factor C | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 395469 | PDGFC | platelet derived growth factor C | 9031 | CGNC:7129 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100568114 | pdgfc | platelet derived growth factor C | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100494492 | pdgfc | platelet derived growth factor C | 8364 | XB-GENE-985688 | Inparanoid, OMA, EggNOG |
| Zebrafish | 560564 | pdgfc | platelet derived growth factor c | 7955 | ZDB-GENE-071217-2 | OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.