Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Ras-related C3 botulinum toxin substrate 2 |
|---|
Gene and Protein Information
| Gene ID | 5880 |
|---|---|
| Uniprot Accession IDs | P15153 Q9UDJ4 |
| Ensembl ID | ENSP00000249071 |
| Symbole | Gx EN-7 HSPC022 p21-Rac2 |
| Family | Belongs to the small GTPase superfamily. Rho family. |
| Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 19354 | Rac2 | Rac family small GTPase 2 | 10090 | MGI:97846 | Inparanoid, OMA |
| Rat | 366957 | Rac2 | Rac family small GTPase 2 | 10116 | RGD:1307568 | Inparanoid, OMA |
| Dog | 481271 | RAC2 | Rac family small GTPase 2 | 9615 | VGNC:49610 | Inparanoid, OMA |
| Horse | 100054701 | RAC2 | Rac family small GTPase 2 | 9796 | VGNC:49130 | Inparanoid, OMA |
| Cow | 327671 | RAC2 | Rac family small GTPase 2 | 9913 | VGNC:49061 | Inparanoid, OMA |
| Opossum | RAC2 | Rac family small GTPase 2 [Source:HGNC Symbol;Acc:HGNC:9802] | 13616 | Inparanoid, OMA | ||
| Platypus | 100092844 | RAC2 | Rac family small GTPase 2 | 9258 | Inparanoid, OMA | |
| Chicken | 418044 | RAC2 | ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) | 9031 | CGNC:9462 | Inparanoid, OMA |
| Anole lizard | 100557692 | rac2 | Rac family small GTPase 2 | 28377 | Inparanoid, OMA | |
| Zebrafish | 415151 | rac2 | Rac family small GTPase 2 | 7955 | ZDB-GENE-040625-27 | Inparanoid, OMA |
| C. elegans | 186939 | rac-2 | Ras-related protein rac-2 | 6239 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / enzyme modulator / small GTPase / Ras-related C3 botulinum toxin substrate 2
protein / enzyme modulator / small GTPase / Ras-related C3 botulinum toxin substrate 2
DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related C3 botulinum toxin substrate 2
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related C3 botulinum toxin substrate 2
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.