🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

RARA

DescriptionRetinoic acid receptor alpha

Gene and Protein Information

Gene ID5914
Uniprot Accession IDs P10276 B8Y636 P78456 Q13440 Q13441 Q96S41 Q9NQS0 RAR-alpha
Ensembl ID ENSP00000254066
Symbole NR1B1 RAR NR1B1
FamilyBelongs to the nuclear hormone receptor family. NR1 subfamily.
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp454647RARAretinoic acid receptor alpha9598VGNC:9556OMA, EggNOG
Mouse19401Rararetinoic acid receptor, alpha10090MGI:97856Inparanoid, OMA
Rat24705Rararetinoic acid receptor, alpha10116RGD:3534Inparanoid, OMA
Dog480526RARAretinoic acid receptor alpha9615VGNC:45351Inparanoid, OMA
Horse100054274RARAretinoic acid receptor alpha9796VGNC:22184Inparanoid, OMA
Cow534280RARAretinoic acid receptor alpha9913VGNC:33729Inparanoid, OMA
Opossum100015353RARAretinoic acid receptor alpha13616Inparanoid, OMA
Anole lizard100562365rararetinoic acid receptor alpha28377Inparanoid, OMA
Xenopus100038052rararetinoic acid receptor alpha8364XB-GENE-480836Inparanoid, OMA
Zebrafish30680raraaretinoic acid receptor, alpha a7955ZDB-GENE-980526-284Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.