Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Pyridoxal kinase |
|---|
Gene and Protein Information
| Gene ID | 8566 |
|---|---|
| Uniprot Accession IDs | O00764 Q7Z2Y0 Q9BS02 |
| Ensembl ID | ENSP00000291565 |
| Symbole | C21orf124 C21orf97 PKH PNK PKH PNK PRED79 C21orf97 HEL-S-1a C21orf124 |
| Family | Belongs to the pyridoxine kinase family. |
| Sequence | MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737076 | PDXK | pyridoxal kinase | 9598 | VGNC:14678 | OMA, EggNOG |
| Macaque | 713564 | PDXK | pyridoxal kinase | 9544 | OMA, EggNOG | |
| Mouse | 216134 | Pdxk | pyridoxal (pyridoxine, vitamin B6) kinase | 10090 | MGI:1351869 | Inparanoid, OMA, EggNOG |
| Rat | 83578 | Pdxk | pyridoxal kinase | 10116 | RGD:621324 | OMA, EggNOG |
| Dog | 487788 | PDXK | pyridoxal kinase | 9615 | VGNC:49939 | Inparanoid, OMA, EggNOG |
| Horse | 100050911 | PDXK | pyridoxal kinase | 9796 | VGNC:49516 | Inparanoid, OMA, EggNOG |
| Cow | 514168 | PDXK | pyridoxal kinase | 9913 | VGNC:50243 | Inparanoid, OMA, EggNOG |
| Opossum | PDXK | pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | PDXK | pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819] | 9258 | OMA, EggNOG | ||
| Chicken | 418549 | PDXK | pyridoxal kinase | 9031 | CGNC:12115 | OMA, EggNOG |
| Anole lizard | 100565761 | pdxk | pyridoxal kinase | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | pdxk | pyridoxal kina [Source:Xenbase;Acc:XB-GENE-5810533] | 8364 | OMA, EggNOG | ||
| Zebrafish | 564697 | pdxkb | pyridoxal (pyridoxine, vitamin B6) kinase b | 7955 | ZDB-GENE-030616-521 | Inparanoid, OMA |
| C. elegans | 172101 | pdxk-1 | Putative pyridoxal kinase | 6239 | Inparanoid, OMA, EggNOG | |
| S.cerevisiae | 856683 | BUD16 | putative pyridoxal kinase BUD16 | 4932 | S000000755 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.