Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Regulator of G-protein signaling 19 |
|---|
Gene and Protein Information
| Gene ID | 10287 |
|---|---|
| Uniprot Accession IDs | P49795 A8K216 E1P5G9 Q53XN0 Q8TD60 RGS19 |
| Ensembl ID | ENSP00000378483 |
| Symbole | GAIP GNAI3IP GAIP RGSGAIP |
| Sequence | MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 56470 | Rgs19 | regulator of G-protein signaling 19 | 10090 | MGI:1915153 | Inparanoid, OMA, EggNOG |
| Rat | 59293 | Rgs19 | regulator of G-protein signaling 19 | 10116 | RGD:629471 | Inparanoid, OMA, EggNOG |
| Dog | 491407 | RGS19 | regulator of G protein signaling 19 | 9615 | VGNC:45528 | Inparanoid, OMA, EggNOG |
| Horse | 100051702 | RGS19 | regulator of G protein signaling 19 | 9796 | VGNC:22347 | Inparanoid, OMA, EggNOG |
| Cow | 539036 | RGS19 | regulator of G protein signaling 19 | 9913 | VGNC:33918 | Inparanoid, OMA, EggNOG |
| Opossum | 100019127 | RGS19 | regulator of G protein signaling 19 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100562817 | rgs19 | regulator of G protein signaling 19 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100145150 | rgs19 | regulator of G-protein signaling 19 | 8364 | XB-GENE-5736048 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 19
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 19
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.