Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Dual specificity tyrosine-phosphorylation-regulated kinase 3 |
|---|
Gene and Protein Information
| Gene ID | 8444 |
|---|---|
| Uniprot Accession IDs | O43781 D3DT79 Q7Z752 Q9HBY6 Q9HBY7 |
| Ensembl ID | ENSP00000356076 |
| Symbole | RED REDK DYRK5 hYAK3-2 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily. |
| Sequence | MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 695163 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9544 | Inparanoid, OMA | |
| Mouse | 226419 | Dyrk3 | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 | 10090 | MGI:1330300 | Inparanoid, OMA |
| Rat | 304775 | Dyrk3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 10116 | RGD:1310924 | Inparanoid, OMA |
| Dog | 480010 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9615 | VGNC:40158 | Inparanoid, OMA |
| Horse | 100055466 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9796 | VGNC:17378 | Inparanoid, OMA |
| Cow | 505149 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9913 | VGNC:28281 | Inparanoid, OMA |
| Opossum | 100014844 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 13616 | Inparanoid, OMA | |
| Chicken | 419846 | DYRK3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 9031 | CGNC:565 | Inparanoid, OMA |
| Anole lizard | 100565585 | dyrk3 | dual specificity tyrosine phosphorylation regulated kinase 3 | 28377 | Inparanoid, OMA | |
| Xenopus | 493520 | dyrk3 | dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 | 8364 | XB-GENE-1008699 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.