🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

MMP17

DescriptionMatrix metalloproteinase-17

Gene and Protein Information

Gene ID4326
Uniprot Accession IDs Q9ULZ9 Q14850 MMP-17
Ensembl ID ENSP00000353767
Symbole MT4MMP MMP-17 MT4MMP MTMMP4 MT4-MMP
FamilyBelongs to the peptidase M10A family.
Sequence
MRRRAARGPGPPPPGPGLSRLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFGYLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAGSAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQALTL
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp452375MMP17matrix metallopeptidase 179598VGNC:5480OMA, EggNOG
Macaque100430708MMP17matrix metallopeptidase 179544Inparanoid, OMA, EggNOG
Mouse23948Mmp17matrix metallopeptidase 1710090MGI:1346076Inparanoid, OMA, EggNOG
Rat288626Mmp17matrix metallopeptidase 1710116RGD:1311541Inparanoid, OMA, EggNOG
Horse100062342MMP17matrix metallopeptidase 179796VGNC:20227Inparanoid, OMA, EggNOG
Cow513072MMP17matrix metallopeptidase 179913VGNC:31522Inparanoid, OMA, EggNOG
Pig100154230MMP17matrix metallopeptidase 179823OMA, EggNOG
Opossum100028499MMP17matrix metallopeptidase 1713616Inparanoid, OMA, EggNOG
Chicken416801MMP17matrix metallopeptidase 179031CGNC:1761Inparanoid, OMA
Anole lizardMMP17matrix metallopeptidase 17 [Source:HGNC Symbol;Acc:HGNC:7163]28377Inparanoid, OMA
Xenopus100125088mmp17matrix metallopeptidase 178364XB-GENE-963679Inparanoid, OMA
Zebrafish570076mmp17amatrix metallopeptidase 17a7955ZDB-GENE-070820-2Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpécificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.