Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Collagenase 3 |
|---|
Gene and Protein Information
| Gene ID | 4322 |
|---|---|
| Uniprot Accession IDs | P45452 A8K846 B2RCZ3 Q6NWN6 |
| Ensembl ID | ENSP00000260302 |
| Symbole | CLG3 MDST MANDP1 MMP-13 |
| Family | Belongs to the peptidase M10A family. |
| Sequence | MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451513 | MMP13 | matrix metallopeptidase 13 | 9598 | VGNC:1095 | OMA, EggNOG |
| Macaque | 703980 | MMP13 | matrix metallopeptidase 13 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17386 | Mmp13 | matrix metallopeptidase 13 | 10090 | MGI:1340026 | Inparanoid, OMA, EggNOG |
| Rat | 171052 | Mmp13 | matrix metallopeptidase 13 | 10116 | RGD:620196 | Inparanoid, OMA, EggNOG |
| Dog | 403763 | MMP13 | matrix metallopeptidase 13 | 9615 | VGNC:43276 | Inparanoid, OMA, EggNOG |
| Horse | 100009711 | MMP13 | matrix metallopeptidase 13 | 9796 | VGNC:49489 | Inparanoid, OMA, EggNOG |
| Cow | 281914 | MMP13 | matrix metallopeptidase 13 | 9913 | VGNC:31518 | Inparanoid, OMA, EggNOG |
| Pig | 397346 | MMP13 | matrix metallopeptidase 13 | 9823 | OMA, EggNOG | |
| Opossum | 100012553 | MMP13 | matrix metallopeptidase 13 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | MMP13 | matrix metallopeptidase 13 [Source:HGNC Symbol;Acc:HGNC:7159] | 9258 | OMA, EggNOG | ||
| Chicken | 395683 | MMP13 | matrix metallopeptidase 13 | 9031 | CGNC:49430 | Inparanoid, OMA |
| Anole lizard | 100552256 | mmp13 | matrix metallopeptidase 13 | 28377 | Inparanoid, OMA | |
| Xenopus | 100490019 | mmp13l | matrix metallopeptidase 13 (collagenase 3) like | 8364 | XB-GENE-481559 | Inparanoid, OMA |
| Zebrafish | 100006896 | mmp13b | matrix metallopeptidase 13b | 7955 | ZDB-GENE-030131-6152 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.