🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

MMP9

DescriptionMatrix metalloproteinase-9

Gene and Protein Information

Gene ID4318
Uniprot Accession IDs P14780 B2R7V9 Q3LR70 Q8N725 Q9H4Z1 Q9UCJ9 Q9UCL1 Q9UDK2 MMP-9
Ensembl ID ENSP00000361405
Symbole CLG4B GELB CLG4B MMP-9 MANDP2
FamilyBelongs to the peptidase M10A family.
Sequence
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp458294MMP9matrix metallopeptidase 99598VGNC:6191OMA, EggNOG
Macaque708084MMP9matrix metallopeptidase 99544Inparanoid, OMA, EggNOG
Mouse17395Mmp9matrix metallopeptidase 910090MGI:97011Inparanoid, OMA, EggNOG
Rat81687Mmp9matrix metallopeptidase 910116RGD:621320Inparanoid, OMA, EggNOG
Dog403885MMP9matrix metallopeptidase 99615VGNC:43290Inparanoid, OMA, EggNOG
Horse100056599MMP9matrix metallopeptidase 99796VGNC:20237Inparanoid, OMA, EggNOG
Cow282871MMP9matrix metallopeptidase 99913VGNC:31531Inparanoid, OMA, EggNOG
Pig654325MMP9matrix metallopeptidase 99823Inparanoid, OMA, EggNOG
Opossum100022144MMP9matrix metallopeptidase 913616Inparanoid, EggNOG
Chicken395387MMP9matrix metallopeptidase 99031CGNC:49293Inparanoid, OMA
Xenopus448591mmp9matrix metallopeptidase 98364XB-GENE-876295Inparanoid, OMA
Zebrafish406397mmp9matrix metallopeptidase 97955ZDB-GENE-040426-2132Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.