Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | NEDD8 |
|---|
Gene and Protein Information
| Gene ID | 4738 |
|---|---|
| Uniprot Accession IDs | Q15843 Q3SXN8 Q6LES6 |
| Ensembl ID | ENSP00000250495 |
| Symbole | NEDD-8 |
| Family | Belongs to the ubiquitin family. |
| Sequence | MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | NEDD8 | magnesium dependent phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:28781] | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 18002 | Nedd8 | neural precursor cell expressed, developmentally down-regulated gene 8 | 10090 | MGI:97301 | Inparanoid, OMA, EggNOG |
| Rat | 25490 | Nedd8 | neural precursor cell expressed, developmentally down-regulated 8 | 10116 | RGD:3158 | Inparanoid, OMA, EggNOG |
| Dog | 480265 | NEDD8 | neural precursor cell expressed, developmentally down-regulated 8 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100051307 | NEDD8 | neural precursor cell expressed, developmentally down-regulated 8 | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 286796 | NEDD8 | neural precursor cell expressed, developmentally down-regulated 8 | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 103101483 | NEDD8 | neural precursor cell expressed, developmentally down-regulated 8 | 13616 | Inparanoid, EggNOG | |
| Xenopus | 549727 | nedd8 | neural precursor cell expressed, developmentally down-regulated 8 | 8364 | XB-GENE-6067551 | Inparanoid, OMA, EggNOG |
| Zebrafish | 368667 | nedd8 | neural precursor cell expressed, developmentally down-regulated 8 | 7955 | ZDB-GENE-030616-588 | Inparanoid, OMA, EggNOG |
| C. elegans | 172910 | ned-8 | NEDD8 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 35151 | Nedd8 | CG10679 gene product from transcript CG10679-RB | 7227 | FBgn0032725 | Inparanoid, EggNOG |
| S.cerevisiae | 851717 | RUB1 | NEDD8 family protein RUB1 | 4932 | S000002546 | OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.