Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Monoglyceride lipase |
|---|
Gene and Protein Information
| Gene ID | 11343 |
|---|---|
| Uniprot Accession IDs | Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 MGL |
| Ensembl ID | ENSP00000265052 |
| Symbole | MGL HUK5 MAGL HU-K5 |
| Family | Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family. |
| Sequence | MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739167 | MGLL | monoglyceride lipase | 9598 | VGNC:2047 | OMA, EggNOG |
| Macaque | 100429242 | MGLL | monoglyceride lipase | 9544 | OMA, EggNOG | |
| Mouse | 23945 | Mgll | monoglyceride lipase | 10090 | MGI:1346042 | Inparanoid, OMA, EggNOG |
| Rat | 29254 | Mgll | monoglyceride lipase | 10116 | RGD:71039 | Inparanoid, OMA, EggNOG |
| Dog | 476511 | MGLL | monoglyceride lipase | 9615 | VGNC:54327 | Inparanoid, OMA, EggNOG |
| Horse | 100053785 | MGLL | monoglyceride lipase | 9796 | VGNC:20161 | Inparanoid, OMA, EggNOG |
| Cow | 505290 | MGLL | monoglyceride lipase | 9913 | VGNC:54454 | Inparanoid, OMA, EggNOG |
| Pig | 100233193 | MGLL | monoglyceride lipase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100027819 | MGLL | monoglyceride lipase | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100559580 | mgll | monoglyceride lipase | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100127203 | mgll | monoglyceride lipase | 8364 | XB-GENE-942085 | Inparanoid, OMA, EggNOG |
| Zebrafish | 378960 | mgll | monoglyceride lipase | 7955 | ZDB-GENE-031006-9 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 853768 | YJU3 | acylglycerol lipase | 4932 | S000001577 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.