Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Corrinoid adenosyltransferase |
|---|
Gene and Protein Information
| Gene ID | 326625 |
|---|---|
| Uniprot Accession IDs | Q96EY8 C5HU05 Q9BSH0 |
| Ensembl ID | ENSP00000445920 |
| Symbole | ATR cob cblB CFAP23 |
| Family | Belongs to the Cob(I)alamin adenosyltransferase family. |
| Sequence | MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452403 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9598 | OMA, EggNOG | |
| Macaque | 708973 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9544 | Inparanoid, OMA | |
| Mouse | 77697 | Mmab | methylmalonic aciduria (cobalamin deficiency) cblB type homolog (human) | 10090 | MGI:1924947 | Inparanoid, OMA, EggNOG |
| Rat | 687861 | Mmab | methylmalonic aciduria (cobalamin deficiency) cblB type | 10116 | RGD:1596242 | Inparanoid, OMA |
| Dog | 486310 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100066641 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 617636 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100157459 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100028469 | MMAB | methylmalonic aciduria (cobalamin deficiency) cblB type | 13616 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 557077 | mmab | methylmalonic aciduria (cobalamin deficiency) cblB type | 7955 | ZDB-GENE-060526-232 | Inparanoid, OMA, EggNOG |
| C. elegans | 175661 | mmab-1 | MethylMalonic Aciduria type B homolog | 6239 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / oxidoreductase / dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
protein / oxidoreductase / dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
protein / Enzyme / Oxidoreductase / Dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.