Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Methylated-DNA--protein-cysteine methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 4255 |
|---|---|
| Uniprot Accession IDs | P16455 Q5VY78 |
| Ensembl ID | ENSP00000302111 |
| Family | Belongs to the MGMT family. |
| Sequence | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737624 | MGMT | O-6-methylguanine-DNA methyltransferase | 9598 | VGNC:7280 | OMA, EggNOG |
| Macaque | 698134 | MGMT | O-6-methylguanine-DNA methyltransferase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17314 | Mgmt | O-6-methylguanine-DNA methyltransferase | 10090 | MGI:96977 | Inparanoid, OMA, EggNOG |
| Rat | 25332 | Mgmt | O-6-methylguanine-DNA methyltransferase | 10116 | RGD:3087 | Inparanoid, OMA, EggNOG |
| Dog | 442978 | MGMT | O-6-methylguanine-DNA methyltransferase | 9615 | VGNC:43213 | Inparanoid, OMA, EggNOG |
| Horse | 100049801 | MGMT | O-6-methylguanine-DNA methyltransferase | 9796 | VGNC:20163 | Inparanoid, OMA, EggNOG |
| Pig | 100155050 | MGMT | O-6-methylguanine-DNA methyltransferase | 9823 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100553369 | mgmt | O-6-methylguanine-DNA methyltransferase | 28377 | Inparanoid, EggNOG | |
| Xenopus | 496878 | mgmt | O-6-methylguanine-DNA methyltransferase | 8364 | XB-GENE-941688 | Inparanoid, OMA, EggNOG |
| Zebrafish | 553368 | mgmt | O-6-methylguanine-DNA methyltransferase | 7955 | ZDB-GENE-120614-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.