🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

MIEN1

DescriptionMigration and invasion enhancer 1

Gene and Protein Information

Gene ID84299
Uniprot Accession IDs Q9BRT3
Ensembl ID ENSP00000377778
Symbole C17orf37 RDX12 XTP4 C35 ORB3 XTP4 RDX12 C17orf37
FamilyBelongs to the SelWTH family.
Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp746327MIEN1migration and invasion enhancer 19598VGNC:9380OMA, EggNOG
Mouse103742Mien1migration and invasion enhancer 110090MGI:1913678Inparanoid, OMA, EggNOG
Rat102552549LOC102552549migration and invasion enhancer 1-like10116RGD:7553401OMA, EggNOG
Dog480532MIEN1migration and invasion enhancer 19615VGNC:43228OMA, EggNOG
Horse100054686MIEN1migration and invasion enhancer 19796VGNC:20180Inparanoid, OMA, EggNOG
Cow505710MIEN1migration and invasion enhancer 19913VGNC:31468Inparanoid, OMA, EggNOG
Pig100516461MIEN1migration and invasion enhancer 19823OMA, EggNOG
Anole lizard100566110mien1migration and invasion enhancer 128377Inparanoid, OMA, EggNOG
Xenopus548750mien1migration and invasion enhancer 18364XB-GENE-969302OMA, EggNOG
Zebrafish378437selenow2aselenoprotein W, 2a7955ZDB-GENE-030428-1OMA, EggNOG
Fruitfly50123CG15456CG15456 gene product from transcript CG15456-RB7227FBgn0040650Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.